[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88275.2
DDBJ      :             RND multidrug efflux membrane permease
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  465/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
b.43.4f.46.1
:400 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->376 2v4dB PDBj 2e-62 43.9 %
:RPS:PDB   13->99 3bg5A PDBj 2e-11 18.8 %
:RPS:PDB   130->203 3bg5D PDBj 1e-05 16.2 %
:RPS:PDB   204->367 3bsdA PDBj 5e-15 9.6 %
:RPS:SCOP  56->298 1t5eA  f.46.1.1 * 4e-36 42.6 %
:RPS:SCOP  270->363 1cneA1  b.43.4.2 * 2e-04 18.2 %
:HMM:SCOP  53->301 1vf7A_ f.46.1.1 * 5.6e-68 47.5 %
:RPS:PFM   69->280 PF00529 * HlyD 2e-12 29.2 %
:HMM:PFM   67->361 PF00529 * HlyD 1.1e-49 26.5 294/306  
:BLT:SWISS 10->376 MEXA_PSEAE 8e-63 43.5 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88275.2 GT:GENE AAK88275.2 GT:PRODUCT RND multidrug efflux membrane permease GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2521024..2522226 GB:FROM 2521024 GB:TO 2522226 GB:DIRECTION + GB:PRODUCT RND multidrug efflux membrane permease GB:PROTEIN_ID AAK88275.2 GB:DB_XREF GI:159140523 LENGTH 400 SQ:AASEQ MSRRILPLFASLCVTAVLAGCSDGGESSKSAGQGAERPPSPVSVIVMKTSEYPLTTVLPGRASAFQTAEIRPRVTGIIREIPFKEGSEVKQGDVLYQIEDNTYLAEVAQAKASVAKAEASVPSAQANLARYERLVNSGATQIEYENAKVTLLQAQADVAQTKAALETAEINLDLTKVRAPFDGITSATAFSIGNVVTANQTTALTTLRRIDPIYIDLMESSTNLLRLKKAISSGQLGGDTKETGIHLTLEDGTEYKHDGKIDMSDMAVSETTGTFSIRALFENPDDLLLPGTYVRATLTIGKEKGFRIPQRAASRNASGELTAKFVTAENKVETRTFPSSQQSGNAWLVTENVKDGDKLIVDGFQWIAEGATVAPVEVTIDDRGIVVLPQQAPPAAAPTK GT:EXON 1|1-400:0| BL:SWS:NREP 1 BL:SWS:REP 10->376|MEXA_PSEAE|8e-63|43.5|336/383| COIL:NAA 30 COIL:NSEG 1 COIL:REGION 145->174| SEG 105->124|aevaqakasvakaeasvpsa| SEG 389->398|pqqappaaap| BL:PDB:NREP 1 BL:PDB:REP 42->376|2v4dB|2e-62|43.9|314/327| RP:PDB:NREP 3 RP:PDB:REP 13->99|3bg5A|2e-11|18.8|85/1137| RP:PDB:REP 130->203|3bg5D|1e-05|16.2|74/1067| RP:PDB:REP 204->367|3bsdA|5e-15|9.6|157/359| RP:PFM:NREP 1 RP:PFM:REP 69->280|PF00529|2e-12|29.2|202/259|HlyD| HM:PFM:NREP 1 HM:PFM:REP 67->361|PF00529|1.1e-49|26.5|294/306|HlyD| GO:PFM:NREP 3 GO:PFM GO:0008565|"GO:protein transporter activity"|PF00529|IPR006143| GO:PFM GO:0009306|"GO:protein secretion"|PF00529|IPR006143| GO:PFM GO:0016020|"GO:membrane"|PF00529|IPR006143| RP:SCP:NREP 2 RP:SCP:REP 56->298|1t5eA|4e-36|42.6|230/231|f.46.1.1| RP:SCP:REP 270->363|1cneA1|2e-04|18.2|88/114|b.43.4.2| HM:SCP:REP 53->301|1vf7A_|5.6e-68|47.5|236/237|f.46.1.1|1/1|HlyD-like secretion proteins| OP:NHOMO 1678 OP:NHOMOORG 470 OP:PATTERN -------------------------------------------------------------------- 235-------------------------------------------------------------------------------------5577-811----1711-D4615--------------221112111222----------------------------1-1--2--------------------1-------------------------------------------------------------------------------------------------------------------------------------1--2-----------1--------------1---31-------------5335112-111-57B97634EA79622342333335-88678977-74-9556567777468911---412112122222222222223435----1----------1--1------------1312456367CCAC56344366A855554686A4877-3445135346332432541735441111111326234-131212235344312214423332212213631112111111-1-------12--2--44255-337222233333565565555554--132-2------43442534555455544-5444555454554444444676422234342344444424223544221243-444444433444--1122123232241635221122--11111113333323111625565758845655356611111111123332222223842369667663332222--1-11--11-----------------------------------------------55 -------------------------------------------------------------------------------------------------------------------------------------------------------------------2-1-------1--------------2-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 369 STR:RPRED 92.2 SQ:SECSTR #######EEEEEcccccccccEcccccTTcTTEEccccEEEEEEcccTTcEEcTTcEEEEEEccccEEEEEccccEEccEEcccTTcEEcTTcEEEEcccccTHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEccccTTcEEEEEEEETTEEEEEEEEcccccccccccccEEEcccccEEEEEcccccEEccTTcccEccEEEEEEEEEEccTTccEEEEEEEEEEccccccccccEEEEEEEEEEETTTTEEEEEEEEEEEETTEEEEEEEEEEEEEccccEEEEEEEEEEETTEEEEEEEEEEEEEEEccccHHHHHHccccccccEEEEccEEEEEEEEEEEEEccccHHHHHHHHHHHcTTcccEEc######################## DISOP:02AL 1-3,23-42,376-401| PSIPRED cccHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEccccEEEEEEcccccEEEcccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEccccEEEEEEEEccccEEcccccEEEEEEEEccEEEEEEEEcHHHHHHHHHHHHHHHHcccccccEEEEEEccccccEEEEEEEEEEcccccccEEEEEEEEEEccccccccccEEEEEEEEcccccEEEccHHHEEEccccEEEEEEccccEEEEEEEEEEEEEccEEEEEEccccccEEEEccHHHcccccEEEEEEccccccccccccccccccccccc //