[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88281.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:62 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88281.2 GT:GENE AAK88281.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2530420..2530608 GB:FROM 2530420 GB:TO 2530608 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK88281.2 GB:DB_XREF GI:159140525 LENGTH 62 SQ:AASEQ MQKQVIEFAGEPVGIVIPDNDRLKFIAVKFHVHDLDEQKFDSADDVRIAIRDLVRSRNLAAA GT:EXON 1|1-62:0| OP:NHOMO 19 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------211121131222------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,60-63| PSIPRED cccEEEEEcccEEEEEEccccEEEEEEEEEEEEEccHHHcccHHHHHHHHHHHHHHHHHccc //