[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88297.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:215 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->204 PF08893 * DUF1839 7e-53 50.5 %
:HMM:PFM   1->205 PF08893 * DUF1839 2.4e-81 47.3 205/320  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88297.2 GT:GENE AAK88297.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2544808..2545455 GB:FROM 2544808 GB:TO 2545455 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK88297.2 GB:DB_XREF GI:159140533 LENGTH 215 SQ:AASEQ MPDTHGVGYQKEHGKTTVAINRLDLEKRELDYFHNAGFFHLSGEDFDGLFQHHLAETDPPFLPYTEFAKFADSNPSPAHIRKTAERLLKFHFSRRPSANPVRAFAKVFPAQVEKVADRPFGFFHKYAFNTLRQLGANFELAASHLEWLDKQGFSDARDHALKISEVAKTVQFQLARAVTRRKFDALATVLDPAADAWDGLMESLGEKLSDASEAA GT:EXON 1|1-215:0| RP:PFM:NREP 1 RP:PFM:REP 1->204|PF08893|7e-53|50.5|204/319|DUF1839| HM:PFM:NREP 1 HM:PFM:REP 1->205|PF08893|2.4e-81|47.3|205/320|DUF1839| OP:NHOMO 47 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- -------------------------------------111---------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1----111111-111-------------------------------------------------------------------------111111-1111111-1111111112222------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,212-216| PSIPRED cccccccHHHHcccccEEEEccccHHHHHHHHHHccccEEEccccHHHHHHccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //