[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88304.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->159 3ihtA PDBj 7e-23 40.3 %
:HMM:SCOP  14->137 1tw3A2 c.66.1.12 * 4.4e-05 21.8 %
:HMM:PFM   6->114 PF00891 * Methyltransf_2 1.1e-05 21.1 90/241  
:BLT:SWISS 38->159 DDL_POLNA 3e-04 30.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88304.2 GT:GENE AAK88304.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2556308..2556790) GB:FROM 2556308 GB:TO 2556790 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88304.2 GB:DB_XREF GI:159140692 LENGTH 160 SQ:AASEQ MSRLDSFIRRLSAQRDILNHVEADLDLPDQGALMEIGLGNGRTFNHLRELFPNRRIIAFDRAMGAHASSVPAVEDLVIGEISQTAPAFIGTDAAMVHADIGTGYPEKDAVTLTWLPDLAAGMLAKGGIAISGLPLDHAMLKPLPVPESVPTDRYFLYRKI GT:EXON 1|1-160:0| BL:SWS:NREP 1 BL:SWS:REP 38->159|DDL_POLNA|3e-04|30.6|111/325| BL:PDB:NREP 1 BL:PDB:REP 2->159|3ihtA|7e-23|40.3|154/160| HM:PFM:NREP 1 HM:PFM:REP 6->114|PF00891|1.1e-05|21.1|90/241|Methyltransf_2| HM:SCP:REP 14->137|1tw3A2|4.4e-05|21.8|110/0|c.66.1.12|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 14 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11-111-111--------------212---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 97.5 SQ:SECSTR #cHHHHHHHHHHHHHHHHHHHHHHTHTTccccEEEEccTTcHHHHHHHHHcccccEEEEEccccccGGGcccGGGEEEccHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHHHHGGGEEEEEEEEccccccc##cEEEcccTTccTTTcEEEEc# DISOP:02AL 1-2,4-4| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHccccEEEEEEEHHHcccccccHHHHHHHHHHHHHHHHHHcccccEEEHHcccccccccHHHHHHccHHHHHHHHccEEEEEcccccccccEEcccccccccccEEEEEEc //