[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88307.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:247 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   76->218 2c1gA PDBj 4e-08 16.9 %
:RPS:SCOP  23->245 1z7aA1  c.6.2.6 * 3e-10 16.2 %
:HMM:SCOP  13->248 2cc0A1 c.6.2.3 * 2.2e-11 21.7 %
:HMM:PFM   40->149 PF01522 * Polysacc_deac_1 1e-07 22.7 97/124  
:BLT:SWISS 123->228 FDL42_ARATH 3e-05 29.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88307.1 GT:GENE AAK88307.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2559357..2560100 GB:FROM 2559357 GB:TO 2560100 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88307.1 GB:DB_XREF GI:15157779 LENGTH 247 SQ:AASEQ MSLKKLTAALDECSRRGIKADLWLRDDDAVEPTLALDILLDLCGSFSVPVTLAVIPEMTTDKLATHLDASDIADVAVHGWSHVNYAGDKEKKQELGPHRDPAIVLDELQSGLDKLHDLHGRRLVPMLVPPWNRVDAGIVTSLADIGYRALSVFGPEKNTVPPCLNTHVDVIDWHGSRGGRDNDILFSETAARILRTAEEGGTTGILTHHLVHDDTVWRFLRQLFEVTTGHPAARWRSSNDLVNEISP GT:EXON 1|1-247:0| BL:SWS:NREP 1 BL:SWS:REP 123->228|FDL42_ARATH|3e-05|29.0|100/376| RP:PDB:NREP 1 RP:PDB:REP 76->218|2c1gA|4e-08|16.9|130/384| HM:PFM:NREP 1 HM:PFM:REP 40->149|PF01522|1e-07|22.7|97/124|Polysacc_deac_1| RP:SCP:NREP 1 RP:SCP:REP 23->245|1z7aA1|3e-10|16.2|210/301|c.6.2.6| HM:SCP:REP 13->248|2cc0A1|2.2e-11|21.7|189/0|c.6.2.3|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------1--1-1-1--111111111111------------111---------------------------------------------------------------------------------------------------------------------------11-1--1--1--------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 212 STR:RPRED 85.8 SQ:SECSTR #####################EHHHHHHHHHTHHTHHHHHHHHHHTTcccEEEEcHHHHHHcHHHHHHHHTTcEEEEcccccccG###########GGccHHHHHHHHHHHHHHHHHHHccc#ccEEccGGGcccHHHHHHcccEEEcccEEccHHHHccHHHHHHHHHHHccTTEGEEEEETTcHHHHHHHHHHHHHHTTcEEccHHHHHGGGcEccHHHHHHHHHHTcccEEEccHHHHHHHH## DISOP:02AL 1-4, 86-99, 156-157| PSIPRED ccHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccEEEEEcccHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccccccccHHHccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccc //