[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88321.2
DDBJ      :             transcriptional regulator, RpiR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  376/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.4.1c.80.1
:287 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   120->212 2i2wD PDBj 2e-05 33.3 %
:RPS:PDB   2->258 2cvpA PDBj 7e-26 12.4 %
:RPS:SCOP  2->72 2o3fA1  a.4.1.20 * 6e-19 29.6 %
:RPS:SCOP  92->262 1jeoA  c.80.1.3 * 3e-17 16.4 %
:HMM:SCOP  88->259 1x94A_ c.80.1.3 * 2.2e-28 32.5 %
:RPS:PFM   6->107 PF01418 * HTH_6 5e-11 38.3 %
:HMM:PFM   1->100 PF01418 * HTH_6 3.9e-20 32.7 98/107  
:HMM:PFM   123->252 PF01380 * SIS 2.9e-17 32.0 128/131  
:BLT:SWISS 2->282 HEXR_PSEAE 1e-36 30.7 %
:PROS 37->55|PS00356|HTH_LACI_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88321.2 GT:GENE AAK88321.2 GT:PRODUCT transcriptional regulator, RpiR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2577218..2578081) GB:FROM 2577218 GB:TO 2578081 GB:DIRECTION - GB:PRODUCT transcriptional regulator, RpiR family GB:PROTEIN_ID AAK88321.2 GB:DB_XREF GI:159140546 LENGTH 287 SQ:AASEQ MDIFARIQDDKGQFSQSERRIADILVSDFEFAVNASIIELAARAEVSPPTVTRFCRRLGCQSFSDFKVSLAKTAYVGVRYLTSEPSSTGPSDVAEEVLAKAQEALFLLHKTLDPALADEAAVKIANSGMIYAFGAGGNSSMIASEIQNRLFRLGLRVSTSADHSMQLMMTAAARKEDVIIGSSFSGRNMELVKCFRLAREMGVTTIALTQSDTPVAAAADMVVAVNVPEGNNIFRPTSSRYAYLAAVDILATLAAYQQRQRSMVTLRHIKQQLVEHRDPDDKQLLGD GT:EXON 1|1-287:0| BL:SWS:NREP 1 BL:SWS:REP 2->282|HEXR_PSEAE|1e-36|30.7|280/285| PROS 37->55|PS00356|HTH_LACI_1|PDOC00366| SEG 215->227|vaaaadmvvavnv| BL:PDB:NREP 1 BL:PDB:REP 120->212|2i2wD|2e-05|33.3|93/178| RP:PDB:NREP 1 RP:PDB:REP 2->258|2cvpA|7e-26|12.4|250/557| RP:PFM:NREP 1 RP:PFM:REP 6->107|PF01418|5e-11|38.3|94/102|HTH_6| HM:PFM:NREP 2 HM:PFM:REP 1->100|PF01418|3.9e-20|32.7|98/107|HTH_6| HM:PFM:REP 123->252|PF01380|2.9e-17|32.0|128/131|SIS| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01418|IPR000281| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01418|IPR000281| RP:SCP:NREP 2 RP:SCP:REP 2->72|2o3fA1|6e-19|29.6|71/83|a.4.1.20| RP:SCP:REP 92->262|1jeoA|3e-17|16.4|165/177|c.80.1.3| HM:SCP:REP 88->259|1x94A_|2.2e-28|32.5|166/191|c.80.1.3|1/1|SIS domain| OP:NHOMO 720 OP:NHOMOORG 381 OP:PATTERN -------------------------------------------------------------------- -------------------------1----------------2--4-----1--1--2--21-1-11---1----1111--------------------------------------------------------------------------------------------------------11---11---11111122211112212222211121--1113244322311222222222222221--21521-32--21311--2422511-333-------1--------------------------122---222321-15---111111-13---1112-------------------1-2------------------1-1--------11111111112----------1--211211111143--11--12-----11--------------1--------------------------------1-------13333333333332443333333342232--3312-11111221311-----1-1111111-----------------------------------------------------------------21311-1-2-11211111111111111111-------------421133-2222222222-2222323223222222224323111143433333332433334422322221-222222222222---------------231111-11111111122----------3122222333222222333----------2333333332224411--------------------------------1--------------------------321-22212--- --------------------------------------------------------------------------------------------------------------------------------------------------------------2----1------1--1--------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 277 STR:RPRED 96.5 SQ:SECSTR #HHHHHcTTHHHHTEcccEEEEEcTTccccHHHHHHHHHHHHHTTHHHHHHHHHTTccccTTTTccccHHHHTcTTccccEETTTccTTTEEcHHHHHHHHHHHHHHHHHHHTTcHcccTTcccccEEEEEccGGGTHHHHHHHHHTGGGGTTccEEccccHHHHHHHHTTccTTcEEEEEEccccccHHHHHHHHHHHHHHHHHHccGEEccHHHHHHHTccGGGEEEccTTccGGGcTTTGGGHHHHHHHcHHHHHcccHHHHHHHHHHHHTTHHH######### DISOP:02AL 82-87,270-270,281-283,286-288| PSIPRED ccHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHccHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHcccEEEEEEccccHHHHHccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //