[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88322.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   10->155 2chcA PDBj 2e-04 15.2 %
:RPS:SCOP  11->160 3ebyA1  d.17.4.4 * 5e-05 11.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88322.1 GT:GENE AAK88322.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2578325..2578810 GB:FROM 2578325 GB:TO 2578810 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88322.1 GB:DB_XREF GI:15157798 LENGTH 161 SQ:AASEQ MRDPFKNPFTETDTARHSIWEMLVTRDIDAFLAADWSKVADDFVEDGFLGINANRDANPDNWRLSFPSLAAYRDEWLKQAKDFQTQQFSEDPRHAIFTTTTLEEIELEGETALVRKKFDGGLRKADGSFDAMKWQTLYYCRLHQGRWKISGFTGYMPNPMP GT:EXON 1|1-161:0| SEG 98->111|ttttleeieleget| RP:PDB:NREP 1 RP:PDB:REP 10->155|2chcA|2e-04|15.2|125/169| RP:SCP:NREP 1 RP:SCP:REP 11->160|3ebyA1|5e-05|11.3|141/153|d.17.4.4| OP:NHOMO 22 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-111111----------1--11-111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 134 STR:RPRED 83.2 SQ:SECSTR #########HHHHHHHHHHHHHHHHHHHHHHTTTcHHHHHTTEEEEEEEEETTEEEEcHHHHHHHHHHHHHHccccEcccEEEEEEEEEEETTEEE#################EEEEEEEEEEETTEEEEEEEEEEEEEEEEETTEEEEEEEEEEE#cccT DISOP:02AL 1-3| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHEEEccccccccccEEccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccEEEEEEccEEEEEEHHccccccccccHHHHHHEEEEEEEEcccEEEEEEEEEccccccc //