[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88347.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:128 amino acids
:PSIPRED
:HMM:PFM   13->89 PF04306 * DUF456 0.00014 26.0 77/140  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88347.2 GT:GENE AAK88347.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2609462..2609848) GB:FROM 2609462 GB:TO 2609848 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88347.2 GB:DB_XREF GI:159140557 LENGTH 128 SQ:AASEQ MEFYFPAEFGEQLAFGAAVVSAIIGLFFMFAPGLTLRAFGLQPAGERRDGYALARSSLAGFYLGLGAAALLLAQPMVYLAFGAAFGLSVFGGILSMLSDGGATMRNFLLLVVHFLLSALALSYVFGLV GT:EXON 1|1-128:0| TM:NTM 4 TM:REGION 13->35| TM:REGION 52->74| TM:REGION 78->100| TM:REGION 105->127| SEG 58->73|lagfylglgaaallla| SEG 107->122|flllvvhfllsalals| HM:PFM:NREP 1 HM:PFM:REP 13->89|PF04306|0.00014|26.0|77/140|DUF456| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1111111-------------111-11-1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHc //