[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88351.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
:177 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   44->151 PF11066 * DUF2867 7e-10 35.2 %
:HMM:PFM   19->154 PF11066 * DUF2867 1.3e-47 50.0 136/149  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88351.1 GT:GENE AAK88351.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2614370..2614903) GB:FROM 2614370 GB:TO 2614903 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88351.1 GB:DB_XREF GI:15157832 LENGTH 177 SQ:AASEQ MVALAAPGGWGTEMRNNEDILPGADWCDRFQGEMMTPGMSSLDVSRLLFDHPPAWISGLMALRNRVVSLFGLKTVELVAGASAGGFPVLSSSREQTVLGFDDRHLDFRIVVDLEEQECRQLVSVTTLVRRKNLFGRLYLFAVGPFHRRIVPATMRPFCTDVRPVSTETAWFSRPASG GT:EXON 1|1-177:0| RP:PFM:NREP 1 RP:PFM:REP 44->151|PF11066|7e-10|35.2|108/140|DUF2867| HM:PFM:NREP 1 HM:PFM:REP 19->154|PF11066|1.3e-47|50.0|136/149|DUF2867| OP:NHOMO 44 OP:NHOMOORG 42 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111----111-------------11-1---1-1--111---1---1--------------11---------------------------------------------------------------------11--------2--------------1---1--------1------------1------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------1-2-------------------------------11--------------------------------1-111--1-1------------------------------------------------------------------ -------------------------------------------------1---------------------------------------------------------1--------------------------------------------------1-1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 174-177| PSIPRED cEEEEcccccccccccccccccccccccEEEEccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEcccEEEEcccccEEEEEEEEEEEcccccEEEEEEEEEEEEHHHHHHHHHHHHHHccEEEHHHHHHHHHHHHHHHHccccccccccc //