[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88352.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.21.1
:166 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  5->168 1kqfC_ f.21.1.1 * 4e-18 25.6 %
:HMM:PFM   8->166 PF00033 * Cytochrom_B_N 9.6e-26 24.0 154/188  
:BLT:SWISS 81->163 C56H_ECOLI 2e-04 39.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88352.2 GT:GENE AAK88352.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2614951..2615451) GB:FROM 2614951 GB:TO 2615451 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88352.2 GB:DB_XREF GI:159140559 LENGTH 166 SQ:AASEQ MASFSQVSFSIPQRVIHWAMALLIFFNLLFPDAMAHAYRLMRRGETLTPDQISSANIHAYVGFAILLLAVLRLCLRFFQGVPPHPAEEPRASQIAAKAAHFTFYVLFFILPLSGIAAYYFGIATAGELHSGPFKAVMWVLIAGHVAAVLVHQFYWRTNVLKRMTHG GT:EXON 1|1-166:0| BL:SWS:NREP 1 BL:SWS:REP 81->163|C56H_ECOLI|2e-04|39.2|79/176| TM:NTM 4 TM:REGION 17->39| TM:REGION 57->79| TM:REGION 103->125| TM:REGION 133->155| SEG 66->75|lllavlrlcl| HM:PFM:NREP 1 HM:PFM:REP 8->166|PF00033|9.6e-26|24.0|154/188|Cytochrom_B_N| HM:SCP:REP 5->168|1kqfC_|4e-18|25.6|156/0|f.21.1.1|1/1|Transmembrane di-heme cytochromes| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------11-11-111----------1111--------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------1----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //