[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88360.2
DDBJ      :             putative malate dehydrogenase
Swiss-Prot:MDH_AGRT5    RecName: Full=Malate dehydrogenase;         EC=1.1.1.37;

Homologs  Archaea  53/68 : Bacteria  631/915 : Eukaryota  190/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.162.1
:320 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->319 3gvhA PDBj e-156 84.3 %
:RPS:PDB   6->320 2d4aD PDBj 4e-97 38.9 %
:RPS:SCOP  62->310 1obbA2  d.162.1.2 * 4e-46 13.2 %
:HMM:SCOP  4->144 1gv0A1 c.2.1.5 * 1.3e-45 43.3 %
:HMM:SCOP  146->314 1ldnA2 d.162.1.1 * 3.7e-55 44.3 %
:RPS:PFM   4->143 PF00056 * Ldh_1_N 2e-27 48.5 %
:RPS:PFM   148->301 PF02866 * Ldh_1_C 3e-28 41.8 %
:HMM:PFM   147->303 PF02866 * Ldh_1_C 1.6e-36 34.0 156/174  
:HMM:PFM   5->143 PF00056 * Ldh_1_N 9.6e-33 37.0 138/142  
:BLT:SWISS 1->320 MDH_AGRT5 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88360.2 GT:GENE AAK88360.2 GT:PRODUCT putative malate dehydrogenase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2624795..2625757) GB:FROM 2624795 GB:TO 2625757 GB:DIRECTION - GB:PRODUCT putative malate dehydrogenase GB:PROTEIN_ID AAK88360.2 GB:DB_XREF GI:159140563 LENGTH 320 SQ:AASEQ MARKKIALIGSGMIGGTLAHLASLKELGDIVLFDIADGIPQGKGLDIAQSGPVEGFNAKLSGASDYAAIEGADVCIVTAGVARKPGMSRDDLLGINLKVMEQVGAGIKKYAPNAFVICITNPLDAMVWALQKFSGLPKNKVVGMAGVLDSARFRLFLAEEFNVSVQDVTAFVLGGHGDTMVPLARYSTVGGVPLTDLVKMGWLTAERLEQIIQRTRDGGAEIVGLLKTGSAYYAPAASAIEMAESYLKDKKRVLPAAAHLSGQYGVDDMYVGVPTIIGAGGIERVIEIELNKEEEAAFQKSVGAVAGLCEACINIAPSLK GT:EXON 1|1-320:0| SW:ID MDH_AGRT5 SW:DE RecName: Full=Malate dehydrogenase; EC=1.1.1.37; SW:GN Name=mdh; OrderedLocusNames=Atu2639; ORFNames=AGR_C_4782; SW:KW Complete proteome; NAD; Oxidoreductase; Tricarboxylic acid cycle. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->320|MDH_AGRT5|0.0|100.0|320/320| GO:SWS:NREP 3 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006099|"GO:tricarboxylic acid cycle"|Tricarboxylic acid cycle| BL:PDB:NREP 1 BL:PDB:REP 2->319|3gvhA|e-156|84.3|318/318| RP:PDB:NREP 1 RP:PDB:REP 6->320|2d4aD|4e-97|38.9|306/308| RP:PFM:NREP 2 RP:PFM:REP 4->143|PF00056|2e-27|48.5|136/141|Ldh_1_N| RP:PFM:REP 148->301|PF02866|3e-28|41.8|153/169|Ldh_1_C| HM:PFM:NREP 2 HM:PFM:REP 147->303|PF02866|1.6e-36|34.0|156/174|Ldh_1_C| HM:PFM:REP 5->143|PF00056|9.6e-33|37.0|138/142|Ldh_1_N| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00056|IPR001236| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00056|IPR001236| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02866|IPR001236| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02866|IPR001236| RP:SCP:NREP 1 RP:SCP:REP 62->310|1obbA2|4e-46|13.2|234/307|d.162.1.2| HM:SCP:REP 4->144|1gv0A1|1.3e-45|43.3|141/0|c.2.1.5|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 146->314|1ldnA2|3.7e-55|44.3|167/0|d.162.1.1|1/1|LDH C-terminal domain-like| OP:NHOMO 1784 OP:NHOMOORG 874 OP:PATTERN 11-1--1111111111-111111111111111-111111111122222--1111------1111--12 121--12211112--------1----------1111-1--1--1-1--1-----111---11-3---1---12222221-2-12111122221211---11111111121---------------111111111212221111111222-11211--------11-2112-------------1-11111-2224444444444444442222224442222223444444223222222222222213221323123325333555533222113344222111121111111111111111111111111111122211111--241111111212211111112122-1112211-22-1--111-1-1-123111111111111111111211111111111111-111111111111111211111111111111111111111------------11211111111111111111111111111111111111--1111--------------------1-------------1-----------1--------------------1-1-------11--121111111222212-111111222221-1-------11112111121--111111111111111111111111---1--2------22111211111111111-111111111111111111122211111111111111111111111111111--111111111111--1---------------111111111111111----------------1----111-----111111111-11111111112122----------------11--1111111111111-1----1-1111-11111111111---1111-11111111 3422--2-C53-2232244332324232222222222212222222222333372333433323333633233233323333333311-23222222122221434-23-239555653425638A2M4Jk9-B8F2333C53B636344563F3554422452133542E22216333*33333ABPH39512-2221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 320 STR:RPRED 100.0 SQ:SECSTR ccccEEEEEcccHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHHHHTccccEEEEccGGGGTTccEEEEcccccccTTccHHHcHHHHHHHHHHHHHHHHHHcTTcEEEEccccHHHHHHHHHHHHcccGGGEEEccHHHHHHHHHHHHHHHHTccGGGEEccEEccccTTcEEcGGGcEETTEETTTTHcHHHccHHHHHHHHHHHHHHHHHHHTHHHcccccHHHHHHHHHHHHHHHHTccEEEEEEEEEEcGGGcEEEEEEEEEEEETTEEEEEccccccHHHHHHHHHHHHHHHHHHTTccGccGGGc DISOP:02AL 1-2| PSIPRED ccccEEEEEcccHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHccccccccEEEEcccHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHccccHHHEEEEccHHHHHHHHHHHHHHHcccHHHEEEEEEEcccccEEEEEcccEEccEEHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccccEEEEEEEEEEcccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //