[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88369.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  86/915 : Eukaryota  48/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:214 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  29->202 1wy7A1 c.66.1.32 * 1.6e-19 26.6 %
:HMM:PFM   76->128 PF06325 * PrmA 2.8e-13 49.1 53/295  
:BLT:SWISS 4->213 CL072_DANRE 2e-23 32.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88369.1 GT:GENE AAK88369.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2632044..2632688) GB:FROM 2632044 GB:TO 2632688 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88369.1 GB:DB_XREF GI:15157854 LENGTH 214 SQ:AASEQ MRTDPERFILDNAAIMHPPHVPELRLHLATEAHELWLKTEEELEEIGLPPPFWAFAWAGGQGLARYILDHPESVCGKRVLDFASGSGLVAIAAAKAGAAKVLAADIDPWTETAIRLNAALNGVDIGFTGLDLVGKPVDADVLLAGDVFYDRAFADLLVPWFVELTEKGMIVLVGDPGRAYLPKERLRAEATYQVPVTRALEDSDVKKTTVWRFI GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 4->213|CL072_DANRE|2e-23|32.9|207/258| SEG 34->48|elwlkteeeleeigl| SEG 87->107|glvaiaaakagaakvlaadid| HM:PFM:NREP 1 HM:PFM:REP 76->128|PF06325|2.8e-13|49.1|53/295|PrmA| HM:SCP:REP 29->202|1wy7A1|1.6e-19|26.6|173/0|c.66.1.32|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 148 OP:NHOMOORG 134 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------22--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----1-------1111111111111111-11111111-21-11112211111111-11------------------11111111----------------------------------------------------------------------------------------------------------------------------------1111-1---------------------------------1---------------------------------------------------------------------------------------------------------------------------------------11-----------------111111----1--11111111-111-111------------------------------------------------------------------------------------------------- --------------1-----------------------------------------------------------------------------------------------212112---1-11121111321-11112111111-11-1-11-1-1111----2111-11-1------1-------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccHHHHHHHccccccccccHHHHHHHcccccHHHcccccccHHcccccccEEEEEHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccEEEEEcccccccccccEEEEccHHcccHHHHHHHHHHHHHHccccEEEEEcccccccccccEEEEEEEcccEEEEEcccccEEEEEEEEc //