[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88391.2
DDBJ      :             RhtB family transporter
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  368/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:215 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   24->144 PF01810 * LysE 7e-20 47.1 %
:HMM:PFM   19->210 PF01810 * LysE 7.3e-37 29.9 187/192  
:BLT:SWISS 24->209 Y4757_PSEAE 4e-17 31.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88391.2 GT:GENE AAK88391.2 GT:PRODUCT RhtB family transporter GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2653761..2654408 GB:FROM 2653761 GB:TO 2654408 GB:DIRECTION + GB:PRODUCT RhtB family transporter GB:PROTEIN_ID AAK88391.2 GB:DB_XREF GI:159140575 LENGTH 215 SQ:AASEQ MDFVPSLPTLIAFTIAILLLAVTPGPDMTLWISRSLREGRAAGFMTLVGTNIGITVHTMLVAFGVAALIVASPTAFMILKTGGAAYLVWLAIQAIRKGSDFVMVKSTGEKAQASLKSALLNGIWVNLLNPKVIIFFMTFLPQFVSATDPHVTGKLIFLGIWSIIVALPIGIGIVVTADILSAWLQRNRKVLRGLDYTIAGVFSLFAVKIFFTQTR GT:EXON 1|1-215:0| BL:SWS:NREP 1 BL:SWS:REP 24->209|Y4757_PSEAE|4e-17|31.9|182/216| TM:NTM 4 TM:REGION 2->24| TM:REGION 45->67| TM:REGION 74->95| TM:REGION 159->181| SEG 7->23|lptliaftiailllavt| RP:PFM:NREP 1 RP:PFM:REP 24->144|PF01810|7e-20|47.1|119/190|LysE| HM:PFM:NREP 1 HM:PFM:REP 19->210|PF01810|7.3e-37|29.9|187/192|LysE| GO:PFM:NREP 2 GO:PFM GO:0006865|"GO:amino acid transport"|PF01810|IPR001123| GO:PFM GO:0016020|"GO:membrane"|PF01810|IPR001123| OP:NHOMO 997 OP:NHOMOORG 378 OP:PATTERN ----------------------------1---------11111-------111--------------- ----4211222--------------1------2---1321-1-----1----122------11-117------------------------------------1-----1----------------1-11---1--111-----1----------------------------------------1--------232333132212121-322-1222-332---------5----------------11111----------------------------------------------------------------------------------------------1----------1-----------------444-111-1--533---2212222122221115--11114112A1-69955386455711--11431--1214--------1111-11---------------------------------1--23315899998644446669444443C644354--556-23222-3154--3--1-22----------12--11-415-214--3--2-111-22----1-----1-------1----------1-----33312-2-2122434423433332345335--------------4731162212222222-22222222222222222224344633222122222222222224-11--11--211111111111---1-----1211-15391111-----------7779723111--221234423333322-4---------12457444446574211--------1111---------------------------------------------------------1- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,97-117,215-216| PSIPRED ccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcc //