[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88392.1
DDBJ      :             ABC transporter, nucleotide binding/ATPase protein
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  896/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:264 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   2->228 2it1B PDBj 2e-20 34.3 %
:RPS:PDB   2->228 3b5jA PDBj 1e-29 25.1 %
:RPS:SCOP  1->225 1sgwA  c.37.1.12 * 2e-29 21.3 %
:HMM:SCOP  2->235 1pf4A1 c.37.1.12 * 2.7e-48 37.2 %
:RPS:PFM   46->177 PF00005 * ABC_tran 7e-10 38.8 %
:HMM:PFM   46->177 PF00005 * ABC_tran 4e-19 36.2 116/118  
:HMM:PFM   150->222 PF09818 * ABC_ATPase 0.00021 30.1 73/448  
:HMM:PFM   18->56 PF03193 * DUF258 1.7e-05 26.3 38/161  
:BLT:SWISS 21->247 PHNC2_TRIEI 3e-25 32.9 %
:PROS 149->163|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88392.1 GT:GENE AAK88392.1 GT:PRODUCT ABC transporter, nucleotide binding/ATPase protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2654447..2655241) GB:FROM 2654447 GB:TO 2655241 GB:DIRECTION - GB:PRODUCT ABC transporter, nucleotide binding/ATPase protein GB:PROTEIN_ID AAK88392.1 GB:DB_XREF GI:15157881 LENGTH 264 SQ:AASEQ MISLSDIQVVFGRGTPLQKQALAKIDLTIEDGSFVTVIGSNGAGKSTLLGVLAGDVLPTAGKVMIGGADVTRKPTASRAGRVARVFQDPLAGSCGALTIEENLALAASRGERRGLSSALGRGRRDFFRERIASLNLGLENRLKDRMDLLSGGQRQAVSLVMATLSGSDVLLLDEHTAALDPGMAEFVMELTRKVVSERKLTTLMVTHSMRQALDYGTRTIMLHAGEIVLDVSGDSRKDLEVEDLIEMFRKIRGQTLDDDELLIG GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 21->247|PHNC2_TRIEI|3e-25|32.9|225/260| PROS 149->163|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 106->124|aasrgerrglssalgrgrr| BL:PDB:NREP 1 BL:PDB:REP 2->228|2it1B|2e-20|34.3|210/361| RP:PDB:NREP 1 RP:PDB:REP 2->228|3b5jA|1e-29|25.1|215/243| RP:PFM:NREP 1 RP:PFM:REP 46->177|PF00005|7e-10|38.8|121/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 46->177|PF00005|4e-19|36.2|116/118|ABC_tran| HM:PFM:REP 150->222|PF09818|0.00021|30.1|73/448|ABC_ATPase| HM:PFM:REP 18->56|PF03193|1.7e-05|26.3|38/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->225|1sgwA|2e-29|21.3|197/200|c.37.1.12| HM:SCP:REP 2->235|1pf4A1|2.7e-48|37.2|223/244|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 20077 OP:NHOMOORG 1154 OP:PATTERN AA627453A78698C6L2CCCCBENCDGFAIA427542768539E6BH88PGF6AD96B79895E-12 GCGCjGIENNQC98CBC99-9G22Hb99999CIIJJVXcWAPEaOHMGHFC8KPJA7F33MNRIOIPpaiIJHHHTHHFCYHQ33322AA8A3779A--47C889C7H8C222222212244447BE7DBBB78D9KLLQY533OHMGKJLKJKMBB7997A4IIHLYedE7989674A7A56EFIABJK6FIKaadZdfkkVgighijeQOOKQifhIRQfVPPQSSPSQqkEJJJJKJGJJJJJJIGGFIATNIGTUG8PGRRQEEUVOG9EGHJJJMMNSQLPQRRPQQQNMORPQPFFGGGFHHFHGGHUMMGFFONOMKTKVVYYYeZaYGYGKTXX9MLHbGLOKgHIA7inMDGBNE9JBA9I69HC8EIGGBBDBAAFC***IGKomjhWcdaddYfZYa*-IRmIFiJdf*H3************vnB7BcTueUcdgWWAAAAAAAAREH7AJIO332-1222--4443341443224432132856936WneNpUhkimaQLNNNZZw*SQPQLTeX*ahna67TTRVFVMNdWnhn*IOH7I8DKB5645745BD6GKJFRZABBMJDNKEFE8KBFDD9GAHJKKIPQES86766898A993312211113B76476KKPAP9D5C7R7CDCA59BA8A76AB779A--577A8-11---dUlWEaTUVUWVWVVTU-UUUUWSTUUVVVVSSTSSRglkdgJLFPNLNPOMNONMOOONOhMKKQPRQ91RWXYaXWXWXaX--4423222758786SNjCCABCA6BABA667CBBCAB6E8BCCJOPNPIVVSORRMMOXYd3332333237FLLQIIJJIRQPJL8B8899899A57671-8744666632211-11V6D44344-2231455444657323333AFMB5JUKNM5EA --119C8-92-49AC94785CD8C8BBAA7968DB93666366465669DC9D954A557566314322132341222124112-143-27445344545316C86-5GGO669DAC5473ACAQP2M2b*E-GBL5974F47JE46743C62S5DC8P6Hf4JC65Q8DqPPAC6835h25427SHOm7PM62MHHK2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 116-120| PSIPRED cEEEEEEEEEEcccccccEEEEcccccEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHccEEEEcccccccccccHHHHHHHcHHHHccccccHHHHHHHHHHHHHHHHHHHccHHHHHcccHHHcccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEEccEEEEEcccHHHHHccHHHHHHHHHHccccEEccccEEcc //