[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88396.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  71/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:167 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   26->167 3dtdD PDBj 2e-28 14.7 %
:RPS:PFM   116->163 PF06776 * IalB 4e-08 50.0 %
:HMM:PFM   93->161 PF06674 * DUF1176 2e-07 30.3 66/340  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88396.2 GT:GENE AAK88396.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2658727..2659230) GB:FROM 2658727 GB:TO 2659230 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88396.2 GB:DB_XREF GI:159140693 LENGTH 167 SQ:AASEQ MFVRSVATAAAILLTSVGLASAQSPTRIQQFNAWGAYSYKSGNSTVCYVLSIPTSKEPASVDHGDIFFIVSQRPGQNISYEPQAMVGYTLKQGSKVNVTIDNKNFVMFTKDKAAWVENAAEEPALVAAMKGGKSMTVKAVSGRGTATSYSYSLSGISAAFKQIESCK GT:EXON 1|1-167:0| TM:NTM 1 TM:REGION 2->24| RP:PDB:NREP 1 RP:PDB:REP 26->167|3dtdD|2e-28|14.7|136/145| RP:PFM:NREP 1 RP:PFM:REP 116->163|PF06776|4e-08|50.0|48/133|IalB| HM:PFM:NREP 1 HM:PFM:REP 93->161|PF06674|2e-07|30.3|66/340|DUF1176| OP:NHOMO 75 OP:NHOMOORG 71 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111112-11111111111111-211113111111111111111-11-------------111----------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 85.0 SQ:SECSTR #########################cccEEETTEEEEEEEETTEEEEEEEEEEEcTTccEETTccEEEEEEEEEcTTccEEEEEEEcccTTccEEEEETTcccEEEEcEEETTEEEEEEEEcHHHHHHHHHccEEEEEEETTccEEEEEEEEcTTHHHHHHHHHHHH DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHHHHcccccccccEEEEEccEEEEEEccccccEEEEEEEcccccccccccccEEEEEEEEcccccccEEEEEEEcccccccEEEEEEcccEEEEEEcccccccccHHHHHHHHHHHHcccEEEEEEEccccccccEEEEccHHHHHHHHHHHcc //