[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88401.1
DDBJ      :             ABC transporter, nucleotide binding/ATPase protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:236 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   5->222 1l2tB PDBj 1e-45 45.9 %
:RPS:PDB   5->221 3b5jA PDBj 1e-42 28.6 %
:RPS:SCOP  4->221 1b0uA  c.37.1.12 * 1e-39 35.2 %
:HMM:SCOP  8->221 1ii8.1 c.37.1.12 * 3.5e-62 42.8 %
:RPS:PFM   49->171 PF00005 * ABC_tran 2e-17 50.0 %
:HMM:PFM   49->171 PF00005 * ABC_tran 2.1e-24 38.8 116/118  
:HMM:PFM   141->218 PF02463 * SMC_N 0.00023 25.3 75/220  
:HMM:PFM   24->66 PF03193 * DUF258 1.1e-05 31.0 42/161  
:BLT:SWISS 3->225 YBBA_SHIFL 8e-53 46.2 %
:PROS 144->158|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88401.1 GT:GENE AAK88401.1 GT:PRODUCT ABC transporter, nucleotide binding/ATPase protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2662141..2662851 GB:FROM 2662141 GB:TO 2662851 GB:DIRECTION + GB:PRODUCT ABC transporter, nucleotide binding/ATPase protein GB:PROTEIN_ID AAK88401.1 GB:DB_XREF GI:15157892 LENGTH 236 SQ:AASEQ MTKSIIKLKKADLTLGNAAASVHVLKNIDLSIDEGEAVGIVGPSGSGKSTLLMVLAGLERLDSGEIVIADTQLHKLGEDALADFRGRNIGIVFQSFHLIANMTALENVAVPLELANTPNPFEIAKRELVAVGLGERLNHYPGQLSGGEQQRVAIARALAPSPAVLIADEPTGNLDTDTGKQIADLLFAKQAERGMTMVLVTHDPSLAARCSRQIKVRSGEIEGDSARPQMARAVSA GT:EXON 1|1-236:0| BL:SWS:NREP 1 BL:SWS:REP 3->225|YBBA_SHIFL|8e-53|46.2|223/228| PROS 144->158|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 5->222|1l2tB|1e-45|45.9|218/232| RP:PDB:NREP 1 RP:PDB:REP 5->221|3b5jA|1e-42|28.6|213/243| RP:PFM:NREP 1 RP:PFM:REP 49->171|PF00005|2e-17|50.0|114/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 49->171|PF00005|2.1e-24|38.8|116/118|ABC_tran| HM:PFM:REP 141->218|PF02463|0.00023|25.3|75/220|SMC_N| HM:PFM:REP 24->66|PF03193|1.1e-05|31.0|42/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 4->221|1b0uA|1e-39|35.2|213/258|c.37.1.12| HM:SCP:REP 8->221|1ii8.1|3.5e-62|42.8|208/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 51697 OP:NHOMOORG 1172 OP:PATTERN VVLBQJJIVTUSTRYLlJRQOSRbuKPjkTeWICEFEDHGIGDXaSWlMS**i9QZQWVMOJH8X17A VZsM*efgppsQaRdWZRQ-QkCCc*RRRRRSwutwx***V*c*y**gurjT***RYmDDz**r*o****hfedd*ecdR*hmCCEBCUTSN6NDFL--IFWKJOfMYOV8999999CCBBBBBHVTOVcQQZZaUivv**POM*YwnmzhglefTVPNPKNLhlbm***ZJSJJJKKSIIJHeZcPNynBZfw********************y***gmx**kpyxzuux**YklkkkhgijkkkiiYhcZe*dad**bPZYftsQR**ZXOXliijkusxvtmxsvutwstpouzquudddcbdfefeccb*lneccompks***********i*lr***bmmh*rjwy*ckSN**xkadilTcldqpQbafLZaWWOKNNKNfa***bWr****************-sw*oj*q***VC**************LJL**********SRSSSSSS*bfLSnb*78568777765798CD99BB8A99B98B5LFFJCI************************s********CO**w*r*qw******dqrRZKVscKLKKMKKUTPdsmf**TiY*rbrvgerLfdbYZalUeccZep*a*MOMQHOOORMGDDEEFEFEEJUDGMQPwtwU*UkMXS*UZbcZTXeXTUYUYaaaec5-EKYVM331444****c*z**********-************************qsqtupssstturqsussq**x*****W5************34MKFIFFGQRURRN*t*eebeZbLVWSRTRVhPRUSRJVIQVvi*************l***IGGEFIHFGMnrq*vwwww*****RVUOQPONOPGGGG86NSSSJJIKA9798999*BbCCBAC-DCCBGFDPPMDBPBFG77AXoyXXp*proDfN -244dZF-PA69VcTKFLFBKLKQDPGIIBECEOKLCIFIGFEDB9IGENNJXLIIL8CGFGC897873896CAC482889BA87846-CH7FH9IBAAC97DLEE7LdleLYPcbdIDDBFSIoi9jC**f2gSVJEF9gBFdSAKAB7WAA*FZTTrMk*ItNiEsae*jeaRFIDF*OKHBQwah*D*qRQyirmO ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 225-236| PSIPRED ccccEEEEEEEEEEEccccEEEEEEccccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHcccEEEEEccEEEEccccHHHHHcccc //