[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88411.2
DDBJ      :             GGDEF family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  647/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
d.58.29
:381 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   200->362 1w25A PDBj 4e-18 36.2 %
:RPS:PDB   186->341 3btaA PDBj 3e-35 9.7 %
:RPS:SCOP  212->363 1w25A3  d.58.29.2 * 2e-27 36.4 %
:HMM:SCOP  212->363 1w25A3 d.58.29.2 * 2.9e-45 40.1 %
:RPS:PFM   209->359 PF00990 * GGDEF 7e-27 41.7 %
:HMM:PFM   207->360 PF00990 * GGDEF 7.9e-40 37.0 154/161  
:BLT:SWISS 205->362 YDAM_ECOLI 3e-22 40.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88411.2 GT:GENE AAK88411.2 GT:PRODUCT GGDEF family protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2674325..2675470) GB:FROM 2674325 GB:TO 2675470 GB:DIRECTION - GB:PRODUCT GGDEF family protein GB:PROTEIN_ID AAK88411.2 GB:DB_XREF GI:159140584 LENGTH 381 SQ:AASEQ MLTFGVVFLFLHRIGHASARYWGIGYLAAAFGFATPLVLGGLPFEVQAILSNLLFFSAFFLYGHALLTHFERPLYTKARLSIVAVAVLLVSFHVFVTPDLKRELVIGDLVCALLLAFPVWLVRKRPVALADRLMVAIASLVVLETLVRIGMLLVMTPGGSMIELSEFFESDYAFYMQLAASIFGFLLALSVLASQISVTVDRHLHAAEHDPLTDVLNRRGFDRRVPDFRNDTPDGAIIACDIDHFKRINDVYGHAAGDIVLIGLSDLLRRNAPDDALVARFGGEEFVVFLPGQTAAAAGQLANGMRTGLSSLDWRNRGVTSQITASFGVSAVARGDHSIHDAIKRADDSLYAAKRGGRDQVVLEGIRLPAEGPALRVITKA GT:EXON 1|1-381:0| BL:SWS:NREP 1 BL:SWS:REP 205->362|YDAM_ECOLI|3e-22|40.9|154/410| TM:NTM 6 TM:REGION 1->23| TM:REGION 34->56| TM:REGION 79->100| TM:REGION 103->122| TM:REGION 132->154| TM:REGION 175->197| SEG 50->61|lsnllffsaffl| SEG 83->90|vavavllv| BL:PDB:NREP 1 BL:PDB:REP 200->362|1w25A|4e-18|36.2|163/454| RP:PDB:NREP 1 RP:PDB:REP 186->341|3btaA|3e-35|9.7|155/1277| RP:PFM:NREP 1 RP:PFM:REP 209->359|PF00990|7e-27|41.7|151/160|GGDEF| HM:PFM:NREP 1 HM:PFM:REP 207->360|PF00990|7.9e-40|37.0|154/161|GGDEF| RP:SCP:NREP 1 RP:SCP:REP 212->363|1w25A3|2e-27|36.4|151/162|d.58.29.2| HM:SCP:REP 212->363|1w25A3|2.9e-45|40.1|152/0|d.58.29.2|1/1|Nucleotide cyclase| OP:NHOMO 7679 OP:NHOMOORG 655 OP:PATTERN -------------------------------------------------------------------- D934A---111---26211-1H22-111111-C5556G65848Pd-------635-----971-D2H5552---------9157BH66--------------------1----------------11111111151ACC8811184gKQDHH123CC---2--6H8-99F1------------L7A54881682555554552555565-23332555587D2FI333333AC11111111111111111111-121-------3311-1-11111-----------------------------------------------3886J77777777664G445344737--69869EDFC775B8522311--A296883-----25WPQ74HXMGQS4588478678I-XUMSR9NNBT41KPPQVXNXYbFBPB7D9282AC89774--------BCC3-b9M11111111111111111111111-11111-86E9399741FBCEDED8887BBQW999938HRQFOHQ-2IHEVEXKMS12e86QRQSFSTVM-------36DIek4JPGJGLO9dOIHK1HGJWFNESO6646A555C665----------------SAHLD32WSHXaThHfPUmdcecalYeabTaaZVSti---9PBc------AEHA3J7DDDCDCCCEB-BDCED89CDCCBCCDDCCEDGCDF---5377666565786876C7664369--E23333333333---N-----CEDCC8hDm---------------8788826-1-FWPOOOTUVUYUTSROOQW-----2---WLRQQVWVUUWWWnnKNHNHMKABB1111--S25555DD---11111617-------------------------5646567665-1- ----1---------------------------------------------------------------------------------------------------------------------------------------------------------1----4---------52----------1--8-----7---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 193 STR:RPRED 50.7 SQ:SECSTR #############################################################################################################################################################################EEEEEcccGGGTccccccccccTTTTccHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHccccccTTccTTcccccGGGEEEEEcTTccEEEEEccEEEEccccTTccEEEccccccccTTTccccccEEEEccccEEcEEccccTGGGTcTTcccccEEccHHHHHHHHHHHHHHHHHHHTTTcccEEEEEE############### DISOP:02AL 1-1,373-374,378-382| PSIPRED ccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHcHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccEEEEEEEccccHHHHHHHHHHHHHHHHHccEEcccEEEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHcc //