[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88414.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  60/68 : Bacteria  790/915 : Eukaryota  99/199 : Viruses  0/175   --->[See Alignment]
b.40.4c.1.28c.92.1
:424 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   139->330 2qgqA PDBj 4e-11 29.1 %
:RPS:PDB   60->339 2a5hA PDBj 4e-32 10.0 %
:RPS:SCOP  116->345 1qgoA  c.92.1.2 * 2e-30 10.4 %
:RPS:SCOP  366->419 1yezA1  b.40.4.12 * 1e-04 15.1 %
:HMM:SCOP  114->374 1oltA_ c.1.28.2 * 1.3e-48 26.3 %
:RPS:PFM   8->88 PF00919 * UPF0004 3e-05 34.6 %
:RPS:PFM   143->305 PF04055 * Radical_SAM 1e-06 30.0 %
:HMM:PFM   141->313 PF04055 * Radical_SAM 1.7e-24 29.4 160/166  
:HMM:PFM   4->90 PF00919 * UPF0004 1.6e-22 43.7 87/98  
:BLT:SWISS 5->388 Y416_RICPR e-106 53.3 %
:PROS 141->161|PS01278|MTTASE_RADICAL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88414.2 GT:GENE AAK88414.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2678342..2679616) GB:FROM 2678342 GB:TO 2679616 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88414.2 GB:DB_XREF GI:159140586 LENGTH 424 SQ:AASEQ MSGVEVITFGCRLNTYESEVMRAEAEKAGLNNAVLVNTCAVTGEAVRQARQAIRRARRDNPHARIIVTGCAAQTEKQTFADMPEVDAVLGNEEKLKSASYRALPDFGVSAEEKLRVNDIMSIKATAPQMVKHIDGHVRAFIQVQNGCDHRCTFCIIPYGRGNSRSVPMGAVVDQARRLTESGYCEIVLTGVDATSYGADLPGEPSLGYLAKTLLKQVPDIIRLRLSSIDSIEADHHLMDLIADEPRFMPHLHLSLQHGDDMILKRMKRRHLRADAIRFCNEVRSLRPDIAFGADMIAGFPTETEEMLENAATLAEECGISSLHVFPYSPREGTPAVRMPQLDRALVKERAGRLRARGEALKQAHLQNMVGSVQTVLVENSGFAHTDNFTLVAAPDLAPRTLAQVAITGHNGKHLNMKLLAADAA GT:EXON 1|1-424:0| BL:SWS:NREP 1 BL:SWS:REP 5->388|Y416_RICPR|e-106|53.3|377/421| PROS 141->161|PS01278|MTTASE_RADICAL|PDOC00984| SEG 45->58|avrqarqairrarr| SEG 219->231|diirlrlssidsi| SEG 347->361|keragrlrargealk| BL:PDB:NREP 1 BL:PDB:REP 139->330|2qgqA|4e-11|29.1|172/266| RP:PDB:NREP 1 RP:PDB:REP 60->339|2a5hA|4e-32|10.0|259/400| RP:PFM:NREP 2 RP:PFM:REP 8->88|PF00919|3e-05|34.6|81/97|UPF0004| RP:PFM:REP 143->305|PF04055|1e-06|30.0|150/164|Radical_SAM| HM:PFM:NREP 2 HM:PFM:REP 141->313|PF04055|1.7e-24|29.4|160/166|Radical_SAM| HM:PFM:REP 4->90|PF00919|1.6e-22|43.7|87/98|UPF0004| GO:PFM:NREP 5 GO:PFM GO:0003824|"GO:catalytic activity"|PF00919|IPR013848| GO:PFM GO:0009451|"GO:RNA modification"|PF00919|IPR013848| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF00919|IPR013848| GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 2 RP:SCP:REP 116->345|1qgoA|2e-30|10.4|211/257|c.92.1.2| RP:SCP:REP 366->419|1yezA1|1e-04|15.1|53/68|b.40.4.12| HM:SCP:REP 114->374|1oltA_|1.3e-48|26.3|251/0|c.1.28.2|1/1|Radical SAM enzymes| OP:NHOMO 1979 OP:NHOMOORG 949 OP:PATTERN 111111111111111-11-11111-111-1-1111111111111111111111-1111111-1111-1 2331211111111111111-111121111111111111112222211211111111111122222222222111111133331333333333233322233333333313-------22222223333333333332222222222222222222222222222222222222212222212222233333222222222222222222222222222222221-------3222222222222222222221----------------------------------------------------------------------33333333333333343333333333222332333333334333333321233212223323333332233333333333323333-33333333232122222222222233332333333333322222222222223331112222222222222222222222222213333322222222222222222222222221222222222222222222222222222222221111111222222333333323333333333333333222222332333333333333333333333333112222222121122222111222212112111-1121211111122222112222222222-2222222222222222222222221122222222222222222122122221-111111111111---31111122223121122222221112222222222222222222221222211112222211122121211112222211122222222222211111133333333--------32-------------------2------3333333333222 1111112-1---111----------------------------------------------------------------------------------------111-131462222-1111211322518M3-52512--41122121212-142222111523111222-42423334T444442223-243342222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 376 STR:RPRED 88.7 SQ:SECSTR #######ccEEccEEEEEccTccTTccHHH###HHHHHHHHHHHHTTEEEEEEEEccEEcHHHHHTTccccHHHHHHHHTccHHHHTTccTTcTTcHHHHHHcccGGGGcccccTTccccTTcTTTccccTTEEcccccEEEEEEEcccccTTcTTTTTTTccccccHHHHHHHHHHHTcTTccEEEEEEccTTcccHHcccHHHHHHHHHHHHHTcTTccEEHTcEEEEEcEEEccHHHHcGGGccHHHHHHGGGccEEEEEccccGGGccHHHHHHHHHHHHTTccEEEEEEccTTTTTTccHHHHHHHHHHHHTTEEEEEEEcccccTTcGGGcccHHHHHHHHHHHHHHHHGccEEcTTTGGGccHHHTTcccTTcTTcccc###################################### DISOP:02AL 1-1,422-425| PSIPRED ccEEEEEEccccccHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEEccccccccEEEEEEcEEccEEcccHHHHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHcccccccEEEccccccHHHHHHHcccccHHHHHHHHHHHHHHccccEEEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEccccccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccccccEEEEEcccccccEEEEEEEEEcccEEEEEEEEcccc //