[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88433.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  101/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->126 2a4xA PDBj 6e-13 12.9 %
:RPS:SCOP  1->129 1cjxA1  d.32.1.3 * 3e-13 11.5 %
:HMM:SCOP  1->129 1q0oA2 d.32.1.3 * 9.4e-21 27.6 %
:HMM:PFM   77->123 PF00903 * Glyoxalase 1.2e-05 25.5 47/128  
:HMM:PFM   27->90 PF10140 * essB 0.00097 21.9 64/359  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88433.1 GT:GENE AAK88433.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2700386..2700778) GB:FROM 2700386 GB:TO 2700778 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88433.1 GB:DB_XREF GI:15157928 LENGTH 130 SQ:AASEQ MRMIFVNLPVKNIEVSKSFFTALGFSFNPEYSDDRTLCMIVEENIFVMLLQEDRFRDFINGDIADAKQSTEVLTCLSAGSREEIDEMIATALASGGSSWKPVQDHGFMYAGSFQDPDGHVWELVHMTGQG GT:EXON 1|1-130:0| RP:PDB:NREP 1 RP:PDB:REP 1->126|2a4xA|6e-13|12.9|124/131| HM:PFM:NREP 2 HM:PFM:REP 77->123|PF00903|1.2e-05|25.5|47/128|Glyoxalase| HM:PFM:REP 27->90|PF10140|0.00097|21.9|64/359|essB| RP:SCP:NREP 1 RP:SCP:REP 1->129|1cjxA1|3e-13|11.5|122/150|d.32.1.3| HM:SCP:REP 1->129|1q0oA2|9.4e-21|27.6|116/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 134 OP:NHOMOORG 118 OP:PATTERN -------------------------------------------------1------------------ --------111---1---------------------1221---21----11-211-1---------11111-------------------------1----3---121-1----------------------------------1------------------------1----------------------------------------1--1-------1---11111132--------------------1----------------------111----------------------------------------------------------------------------------------------1-----1-------2---------1----------1----------1---11---111-11--------1111----------------------------------------------------2--1111111111-----1111------1-1111------11---111-1---------------------1-2-------------------------1-12------------------------------------------------1111----1----------------------------------------------------------------------------1-----------------------------------------------------------------1-----------------------------------------11----------------------------------------------------------------------- ---------------------------11--11---11111221----11---1--------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 130 STR:RPRED 100.0 SQ:SECSTR ccccEEEEEEccHHHHHHHHHTTccccGGGGGccEEEEEcTTccEEEEEEHHHHHHHcTTccccccccccccEEEEEcccHHHHHHHHHHHHHTTccEEEEEEEETTEEEEEEEcTTccEEEEEEEcccG DISOP:02AL 129-130| PSIPRED cEEEEEEEccccHHHHHHHHHHHccEEccccccccEEEEEEcccEEEEEcccHHHHHHcccccccccccccEEEEEEEccHHHHHHHHHHHHHcccccccccccccccEEEEEEcccccEEEEEEEcccc //