[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88442.2
DDBJ      :             MFS permease
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  96/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:396 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  26->122 1pv6A  f.38.1.2 * 2e-06 21.6 %
:HMM:SCOP  1->389 1pw4A_ f.38.1.1 * 6.9e-50 22.9 %
:RPS:PFM   28->118 PF07690 * MFS_1 3e-05 31.9 %
:HMM:PFM   25->330 PF07690 * MFS_1 4e-32 24.0 304/353  
:BLT:SWISS 24->371 MOSC_RHIME 2e-23 28.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88442.2 GT:GENE AAK88442.2 GT:PRODUCT MFS permease GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2709588..2710778) GB:FROM 2709588 GB:TO 2710778 GB:DIRECTION - GB:PRODUCT MFS permease GB:PROTEIN_ID AAK88442.2 GB:DB_XREF GI:159140601 LENGTH 396 SQ:AASEQ MNGPTTFSPTGTRSSYLTRHRLGVSLLFLMNGFMMGSWAPKIPEFAARLSLSESALGLIILVFGIGSLVFMPIAGSQIARFGSRTVSLVTAAIFLPTLLFISWAGTVWAGVIAVFLFGGLTGAMDVAMNANAVAVERDMRRAIMSSCHAFWSLGGLIGAGLGGYLITAIGVQGHAIALTIIALVLLVIAWPRVLADRPHPEEERPKGGLPLTPLPWIIGLMALFSMIPEGAILDWGALYLRNELGASVSQSGFAFAAFSMTMAAMRFAGDLVRDKFGAVNTLRFCSAMSIIGLIIAGVAGNSTIAIIGFAIAGIGISNMVPIAFSAAGNMPGLAPGIGLSVVTTMGYSGILVAPSAIGFIAEHTGLASVFMALPLLHVVVLLLSRLARHADGAGKE GT:EXON 1|1-396:0| BL:SWS:NREP 1 BL:SWS:REP 24->371|MOSC_RHIME|2e-23|28.3|346/407| TM:NTM 11 TM:REGION 22->44| TM:REGION 55->77| TM:REGION 82->104| TM:REGION 111->133| TM:REGION 144->166| TM:REGION 173->195| TM:REGION 212->234| TM:REGION 244->266| TM:REGION 295->317| TM:REGION 337->359| TM:REGION 367->389| SEG 123->135|amdvamnanavav| SEG 153->170|lggligaglggylitaig| SEG 175->189|aialtiialvllvia| SEG 253->268|fafaafsmtmaamrfa| SEG 304->316|iaiigfaiagigi| SEG 372->390|alpllhvvvlllsrlarha| RP:PFM:NREP 1 RP:PFM:REP 28->118|PF07690|3e-05|31.9|91/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 25->330|PF07690|4e-32|24.0|304/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 26->122|1pv6A|2e-06|21.6|97/417|f.38.1.2| HM:SCP:REP 1->389|1pw4A_|6.9e-50|22.9|388/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 112 OP:NHOMOORG 96 OP:PATTERN -------------------------------------------------------------------- --1-1--------------------------------1---------11-----------------211--------------------------------2--12-2---------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------11111111-11---------11--111112233211-------1-1-------------------------------------------------------1------22-2-11111--111111-111---------1----------1--------------------------------------------------1-----------------------------------------1---------------------------------1--11---------------------------------1111-----------------1---------21111111-111---------------------------------1112111----1-------1-----1---------------------------11----------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,196-209,389-397| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //