[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88445.2
DDBJ      :             transcriptional regulator, LuxR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  136/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.6d.110.5
:245 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->135 3jpuD PDBj 3e-05 26.0 %
:BLT:PDB   184->244 2rnjA PDBj 5e-07 36.1 %
:RPS:PDB   4->154 2avxA PDBj 2e-05 17.5 %
:RPS:PDB   184->243 3cloA PDBj 8e-14 31.7 %
:RPS:SCOP  14->143 1h0mA2  d.110.5.1 * 9e-15 19.7 %
:RPS:SCOP  183->244 1a04A1  a.4.6.2 * 4e-15 25.8 %
:HMM:SCOP  1->171 1l3lA2 d.110.5.1 * 1.5e-30 27.6 %
:HMM:SCOP  162->244 1p4wA_ a.4.6.2 * 5.4e-17 38.6 %
:RPS:PFM   26->154 PF03472 * Autoind_bind 8e-11 29.8 %
:RPS:PFM   182->238 PF00196 * GerE 1e-07 42.1 %
:HMM:PFM   17->163 PF03472 * Autoind_bind 7.4e-29 24.5 143/149  
:HMM:PFM   183->238 PF00196 * GerE 3.9e-19 39.3 56/58  
:BLT:SWISS 23->244 SOLR1_RALSO 1e-15 29.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88445.2 GT:GENE AAK88445.2 GT:PRODUCT transcriptional regulator, LuxR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2715286..2716023) GB:FROM 2715286 GB:TO 2716023 GB:DIRECTION - GB:PRODUCT transcriptional regulator, LuxR family GB:PROTEIN_ID AAK88445.2 GB:DB_XREF GI:159140603 LENGTH 245 SQ:AASEQ MHDILQFISACSQAGSADRVRSEFAKLIREYGFEYFLVSRRMTGELASAGQILAEHLPDGWLEVYRAKKYNLVDPVRKVIGMVHKPFQWKEALEGLPRAMHRKRASVFFHDAGRYGLQGGYAFPVHGRAGFIGAVFIGGPDRQLPSLHVELLDAATRAVFWRLLDLSGQAHGFSNAPDVSALELTRREMEVLALMADGMTSTEIGRQLSISNHTVDWYINGIQRRFSAKNRQHTVALAFRHGLLS GT:EXON 1|1-245:0| BL:SWS:NREP 1 BL:SWS:REP 23->244|SOLR1_RALSO|1e-15|29.6|206/236| BL:PDB:NREP 2 BL:PDB:REP 26->135|3jpuD|3e-05|26.0|104/162| BL:PDB:REP 184->244|2rnjA|5e-07|36.1|61/67| RP:PDB:NREP 2 RP:PDB:REP 4->154|2avxA|2e-05|17.5|143/171| RP:PDB:REP 184->243|3cloA|8e-14|31.7|60/249| RP:PFM:NREP 2 RP:PFM:REP 26->154|PF03472|8e-11|29.8|124/149|Autoind_bind| RP:PFM:REP 182->238|PF00196|1e-07|42.1|57/57|GerE| HM:PFM:NREP 2 HM:PFM:REP 17->163|PF03472|7.4e-29|24.5|143/149|Autoind_bind| HM:PFM:REP 183->238|PF00196|3.9e-19|39.3|56/58|GerE| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 14->143|1h0mA2|9e-15|19.7|122/165|d.110.5.1| RP:SCP:REP 183->244|1a04A1|4e-15|25.8|62/67|a.4.6.2| HM:SCP:REP 1->171|1l3lA2|1.5e-30|27.6|163/0|d.110.5.1|1/1|Pheromone-binding domain of LuxR-like quorum-sensing transcription factors| HM:SCP:REP 162->244|1p4wA_|5.4e-17|38.6|83/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 215 OP:NHOMOORG 136 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1-----------1---------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------3231221-1122111111111111-1111231214--211521421244---1--------111---------------1--------------------------------11------22233333331111-4444-4131-------11--1---------------1----------1----------------------1-1-----------------------------------1122------1--------------------------------------1-1111111-111-1111111111111-11--1------1------------------11----1-----------------------------------------------11111-------3333-1------1-122----------1-------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 241 STR:RPRED 98.4 SQ:SECSTR ###HHHHHHHHHHTccHHHHHHHHHHHHHTTTcccEEEEEEEccTTcccEEEEEEcccHHHHHHHHHTTGGGTcGGGcTTTcTTcEEEcccTTTccGcTTTTcccHHHHHHHHHHTccEEEEEEEccTTccEEEEEEEEcccccccccHHHHHHHHHHHGEEEEEEEEEccccEEEEETTTTTccHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccHHHHHHHHHHTccc# DISOP:02AL 167-183| PSIPRED cHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEEEccccccccccEEEEccccHHHHHHHHHcccHHHcHHHHHHHHccccEEEcHHHHHHHHccccHHHHHHHHHHHHccccccEEEEEEEccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHccccc //