[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88458.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  302/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
:425 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->416 PF06808 * DctM 5e-36 29.8 %
:HMM:PFM   7->415 PF06808 * DctM 2.7e-120 39.6 409/416  
:BLT:SWISS 1->425 Y1029_HAEIN 9e-81 47.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88458.1 GT:GENE AAK88458.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2739894..2741171 GB:FROM 2739894 GB:TO 2741171 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88458.1 GB:DB_XREF GI:15157961 LENGTH 425 SQ:AASEQ MTLFVFVGSLLGAMAIGVPVAFSLMFCGVVLMWYMGMFNTAIIAQNMISGADTFTLLAIPFFILAGELMNSGGLSRRIIDFAIALVGHIRGGLGIVAIVAAIIMASISGSAAADTAALAAILIPMMAKAGYNIPRSGGLIAAGGIIAPVIPPSMAFIVFGVAANVSITQLFLAGIVPGILMGISLIIAWLIVVRKDNIKPLPKTSGKERLVATVRAGWALGMPVIILGGIKAGIMTPTEAAVVAAGYALFVGMVIYRELKPADLFHVLLRAAKSTSIIMFLVCAALVSAWLITAANIPNEVAGYIEPLIDRPMLLMVAMMVLVFIVGTALDLTPTILILTPVLMPIVKQAGIDPVYFGVLFIINNAIGLITPPVGVVLNVVSGVGRIPLGKVTIGVWPFLVAETIVLALLVIFPDIVMVPLQYLR GT:EXON 1|1-425:0| BL:SWS:NREP 1 BL:SWS:REP 1->425|Y1029_HAEIN|9e-81|47.5|425/425| TM:NTM 11 TM:REGION 7->29| TM:REGION 82->104| TM:REGION 114->136| TM:REGION 141->163| TM:REGION 172->193| TM:REGION 211->233| TM:REGION 237->259| TM:REGION 275->297| TM:REGION 315->337| TM:REGION 359->381| TM:REGION 396->418| SEG 94->129|givaivaaiimasisgsaaadtaalaailipmmaka| SEG 137->152|ggliaaggiiapvipp| SEG 313->323|mllmvammvlv| SEG 330->346|ldltptililtpvlmpi| SEG 374->385|vgvvlnvvsgvg| RP:PFM:NREP 1 RP:PFM:REP 7->416|PF06808|5e-36|29.8|410/412|DctM| HM:PFM:NREP 1 HM:PFM:REP 7->415|PF06808|2.7e-120|39.6|409/416|DctM| OP:NHOMO 805 OP:NHOMOORG 307 OP:PATTERN ----------------------------1--------------------------------------- -------1111--------------1------------------1-1-------1-----------1--------------------------1----------1---------------------------------------------------------------------------------1111-------------------8311------11-5------------------------------1----------------------------------------------------------------------71-----------------------2--11--45-2----21-----2-----11--------C891-241333----------4-112112134---14412253219B432-1B6B679AC8A--------2----1-2-----------------------------------1C95A1222211----2231-----12132142-1---6163344F4A21-2----12----------142-3E252621-6332-1-11--11--111---3121---------1--------111-------121-2-611111-1-111111--112----21-------21--11-1--3133322--212333131-22111117---1111-3-323223333232222-1-222---111111111111---1-----------4DK---614-2322-445-------11-1-3333-112411123121------------152222222335--11111---------1-11------------1--------------------------------11121--- --------------------------------------------------------------------------------------------------------------------------------------------------------------2----1------------------------2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 198-208| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //