[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88459.1
DDBJ      :             C4-dicarboxylate binding protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  311/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:335 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   55->262 2ceyA PDBj 2e-29 34.8 %
:RPS:PDB   30->335 3b50A PDBj 3e-32 25.2 %
:RPS:SCOP  76->235 1h3dA1  c.94.1.1 * 5e-08 16.1 %
:RPS:PFM   38->315 PF03480 * SBP_bac_7 3e-56 40.1 %
:HMM:PFM   37->316 PF03480 * SBP_bac_7 7.8e-87 42.3 279/286  
:BLT:SWISS 47->313 Y1028_HAEIN 8e-48 39.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88459.1 GT:GENE AAK88459.1 GT:PRODUCT C4-dicarboxylate binding protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2741202..2742209 GB:FROM 2741202 GB:TO 2742209 GB:DIRECTION + GB:PRODUCT C4-dicarboxylate binding protein GB:PROTEIN_ID AAK88459.1 GB:DB_XREF GI:15157962 LENGTH 335 SQ:AASEQ MRKLLLTTTAIAFAVGAAAPAMAEFNSRNIRVSNGINQDHPVGNGIKAMQACLDDKSGGKLKLTAFWGGALGGDLQATQALRSGVQEAVVTSSSPLVGLIPSLGVFDLPFLFANDKEADAVMDGAFGDMMNKKLEEQGLVNLAYWENGFRNLSNSKHAVNKWEDFSGLKVRVMQNNIFLDTFQNLGANATPMAFGEVFSALETNAIDAQENPYVTIDTSKFYEVQKYVTETNHAYTPFLFLFSKPIFDSYTPEEQTALRECAVVGRDEERKVIRELNQKSLEKIKAAGLEVNTLSPEEQTRIREKSMVVYEKHKAEIGADVVDAVLADLKKIRGQ GT:EXON 1|1-335:0| BL:SWS:NREP 1 BL:SWS:REP 47->313|Y1028_HAEIN|8e-48|39.7|267/328| SEG 10->23|aiafavgaaapama| BL:PDB:NREP 1 BL:PDB:REP 55->262|2ceyA|2e-29|34.8|207/306| RP:PDB:NREP 1 RP:PDB:REP 30->335|3b50A|3e-32|25.2|302/310| RP:PFM:NREP 1 RP:PFM:REP 38->315|PF03480|3e-56|40.1|277/284|SBP_bac_7| HM:PFM:NREP 1 HM:PFM:REP 37->316|PF03480|7.8e-87|42.3|279/286|SBP_bac_7| GO:PFM:NREP 2 GO:PFM GO:0006810|"GO:transport"|PF03480|IPR018389| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03480|IPR018389| RP:SCP:NREP 1 RP:SCP:REP 76->235|1h3dA1|5e-08|16.1|155/220|c.94.1.1| OP:NHOMO 867 OP:NHOMOORG 317 OP:PATTERN --1-------------------------1--------------------------------------- -------1111--------------1------------------1-1-------1-----------1--------------------------1----------1-------------------------------111--------11---------------1---------------------2122---1---------------841111---13416--------1---------------------1----------------------------------------------------------------------71-----------------------2--11--66-21---31-----2-----11--------B89--122222----------4-1181191241--17712154339B542-1739669B978--------2----212-----------------------------------197492222211----2231-----22133321-1---C164459G6E5112----12----------143-F9473521-4332-1-11--11-111----4111---------1--------12--------221-2-41-111-1-111111--111----111------21--11-1--3133322--212323141-22111116---1111-3-323223333-3-222---1122--111111111111--------------11BH---816-2322-445----------1-4444-112711128121------------152222232334--11111---------2-11---------------------------------------------12121--- --------------------------------------------------------------------------------------------------------------------------------------------------------------4----1---------1--------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 308 STR:RPRED 91.9 SQ:SECSTR ###########################EEEEEEccccTTcHHHHHHHHHHHHHHHHTTTcEEEEEEcTTTTccHHHHHHHHHHTcccEEEEcGGGGGGTcGGGGGGGcTTTcccHHHHHHHHccHHHHHHHHHHHHHHcEEEEEEEEEEEEEEEEccccccGGGGTTcEEEEcccHHHHHHHHHTTcEEEEccGGGHHHHHHTTcccEEEEEHHHHHHTTGGGcccEEEcccccEEEEEEEEEHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcEEEccccHHcHHHHHHTHHHHHHHHHHHHHHTHHHHHHHHHTcccc PSIPRED cHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHcccEEEEEEcccHHccccHHHHHHccccccccHHHHHHHHccHHHHHHHHHHHHcccEEEEEEccccEEEEEcccccccHHHHcccEEEEEccHHHHHHHHHcccEEEEccHHHHHHHHHcccccEEEccHHHHHHccHHHHcccEEccccccccEEEEEEHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcc //