[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88525.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  65/915 : Eukaryota  42/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:109 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->82 1x8dA PDBj 6e-10 32.9 %
:RPS:SCOP  1->108 1x8dA1  d.58.4.21 * 1e-12 28.2 %
:RPS:PFM   2->108 PF05336 * DUF718 1e-20 53.3 %
:HMM:PFM   2->109 PF05336 * DUF718 1.9e-43 49.1 106/106  
:BLT:SWISS 1->109 RHAM_OCEIH 4e-14 33.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88525.2 GT:GENE AAK88525.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2815690..2816019) GB:FROM 2815690 GB:TO 2816019 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88525.2 GB:DB_XREF GI:159140642 LENGTH 109 SQ:AASEQ MQRMGMVIGVKPEMIAEYKRLHAAVWPEVLALISESNIRNYTIFLREPENLLFGYWEYHGSDFSADMAKIAASPKNQEWWSFTIPCQQPLESRKEGEWWAMMEETFHLD GT:EXON 1|1-109:0| BL:SWS:NREP 1 BL:SWS:REP 1->109|RHAM_OCEIH|4e-14|33.7|104/104| BL:PDB:NREP 1 BL:PDB:REP 1->82|1x8dA|6e-10|32.9|79/104| RP:PFM:NREP 1 RP:PFM:REP 2->108|PF05336|1e-20|53.3|105/106|DUF718| HM:PFM:NREP 1 HM:PFM:REP 2->109|PF05336|1.9e-43|49.1|106/106|DUF718| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF05336|IPR008000| GO:PFM GO:0016857|"GO:racemase and epimerase activity, acting on carbohydrates and derivatives"|PF05336|IPR008000| GO:PFM GO:0019299|"GO:rhamnose metabolic process"|PF05336|IPR008000| RP:SCP:NREP 1 RP:SCP:REP 1->108|1x8dA1|1e-12|28.2|103/104|d.58.4.21| OP:NHOMO 117 OP:NHOMOORG 107 OP:PATTERN -------------------------------------------------------------------- --1-1--------------------1----------1-------11------111---------1--12---------------------11---------2---2------------------------------11111----1-------------------------------------11-------------------------------------1------------------------------1---------------1--------------------------------------------------------------------------------------------------------------------------------11111111111----------2--122---1---11---1---------1----------------------------------------------------------------------------------------------------1---------------------------------------------------------1-11--1---------------------------------------------------------------------------------------------------------------------------------1--11111111111-----------------------1--------------------------------------------------------------------------------------------------------------------------------------- -----1---------111-11111111-------------------1-111211111-1111-----------1----------------111-1-1111--------2----------------------------------------------------1-----------1-----3--1------1--1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 92 STR:RPRED 84.4 SQ:SECSTR cEEEEEEEEccTTcHHHHHHTTTTccHHHHHHHHHTTEEEEEEEEETTTTEEEEEEEEccHHccGHHHHGGGcHHHHHHHHHccTTcccccE################# DISOP:02AL 1-1| PSIPRED ccEEEEEEEEcHHHHHHHHHHHHcccHHHHHHHHHccccEEEEEEEccccEEEEEEEEEcccHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccccccEEEEccc //