[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAL41059.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:55 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   48->55 PF05671 * GETHR 0.00094 75.0 8/25  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL41059.2 GT:GENE AAL41059.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(31670..31837) GB:FROM 31670 GB:TO 31837 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAL41059.2 GB:DB_XREF GI:159139467 LENGTH 55 SQ:AASEQ MRLTKRAASFLRAPFPQIYEDGIVIGLDSDTPKGGVDEMGCLVEDAAHRTETDRG GT:EXON 1|1-55:0| HM:PFM:NREP 1 HM:PFM:REP 48->55|PF05671|0.00094|75.0|8/25|GETHR| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,48-56| PSIPRED ccHHHHHHHHHHcccHHHHcccEEEEEccccccccHHHHHHHHHHHHHHHHcccc //