[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAL41085.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL41085.1 GT:GENE AAL41085.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 62235..62492 GB:FROM 62235 GB:TO 62492 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAL41085.1 GB:DB_XREF GI:17738375 LENGTH 85 SQ:AASEQ MFPIRAVEDDHVDRTGVEAQQCVKLTVTNSSIDFFVPIDYVHRTKVDDICSVFTLTWPSATTLQTARQTIGDGLASCMAAKLDLE GT:EXON 1|1-85:0| OP:NHOMO 8 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------53---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,85-86| PSIPRED ccccccccccccccccccHHEEEEEEEEcccEEEEEEHHHHHHccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccc //