[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAL41229.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:105 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  6->99 1tuvA_ d.58.4.11 * 1.8e-19 32.3 %
:RPS:PFM   10->77 PF03992 * ABM 1e-04 32.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL41229.1 GT:GENE AAL41229.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 211253..211570 GB:FROM 211253 GB:TO 211570 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAL41229.1 GB:DB_XREF GI:17738533 LENGTH 105 SQ:AASEQ MASDEPVVRMAEIEIDPTHLEAYRRLLAEEIEASVRLENGVLALNAVAIKGSPEKLRILEVYANQAAYEAHLQTPHFLKYKEGVAGMVTSLTLIEVEPVMMRSKP GT:EXON 1|1-105:0| RP:PFM:NREP 1 RP:PFM:REP 10->77|PF03992|1e-04|32.4|68/78|ABM| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF03992|IPR007138| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF03992|IPR007138| GO:PFM GO:0017000|"GO:antibiotic biosynthetic process"|PF03992|IPR007138| HM:SCP:REP 6->99|1tuvA_|1.8e-19|32.3|93/0|d.58.4.11|1/1|Dimeric alpha+beta barrel| OP:NHOMO 28 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- -1--------------------------------------------------------------------------------------111--1----------1--1-------------------------------------------------------------1--------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------1--1-------2---1-11121--------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------1---------------------------------------------------------------1-1---------------------------------1----------------------------------------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,104-106| PSIPRED cccccEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccccEEEEEEEEccHHHHHHHHccHHHHHHHHHHHHHccccEEEEEEccEEcccc //