[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAL41771.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:100 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   17->96 PF07076 * DUF1344 3e-24 63.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL41771.1 GT:GENE AAL41771.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 753122..753424 GB:FROM 753122 GB:TO 753424 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAL41771.1 GB:DB_XREF GI:17739124 LENGTH 100 SQ:AASEQ MHVRFSRKFTKARSMRMMIAALLATANLLMPINSFAQSVDVEGTISKIDANGLSITLNDGKTYRVPEEFNFEGLKAGVKVVVFYTEVDGKRVVDDLQVVE GT:EXON 1|1-100:0| RP:PFM:NREP 1 RP:PFM:REP 17->96|PF07076|3e-24|63.3|79/80|DUF1344| OP:NHOMO 15 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------2--12-111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED ccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccEEEEEEEEEcccccEEEEcccEEEEEcccccccccccccEEEEEEEcccccEEEEEEEEEc //