[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAL41821.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:157 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL41821.1 GT:GENE AAL41821.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 806549..807022 GB:FROM 806549 GB:TO 807022 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAL41821.1 GB:DB_XREF GI:17739178 LENGTH 157 SQ:AASEQ MLHFLHAFSREVAEDTPISSAIKGWTCVFVALSGNYSLNRQECGKIFSFLVAVACPSVGAISEARRASAFGRSVAYRGPCPLRSGLSFWTRHKTLIRIGFPDFRLNRRPKKSGVVRWEGKSCQLRRRHPRACPEDLPTYCFYSTWLDPRPKAEDDVE GT:EXON 1|1-157:0| TM:NTM 2 TM:REGION 17->39| TM:REGION 41->63| OP:NHOMO 3 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 150-158| PSIPRED cHHHHHHHHHHHHHcccHHHHcccEEEEEEEEcccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccHHHHcccEEEEEEccccccccccccccEEEEEccccEEEHHcccccHHHcccHHHHHHccccccccccccc //