[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAL41939.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:182 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL41939.1 GT:GENE AAL41939.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(913645..914193) GB:FROM 913645 GB:TO 914193 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAL41939.1 GB:DB_XREF GI:17739306 LENGTH 182 SQ:AASEQ MLRILLAIITGLVAAAVLHVIVILAIPHFSNRDAYTRALAEGRPHLFHLLEETTEKKTLGSGDPFMRVAVCTFNIEEQPVRLTAIGAVPFWSVAVYDKASNEVFSMNDRTSAGGEMDILVADAVQIAAIRKAQPPALSQAILAESDQTEGYVVLRTMVPQPSFGEEAERFLNEAKCQPTPWK GT:EXON 1|1-182:0| TM:NTM 1 TM:REGION 5->27| SEG 12->26|lvaaavlhvivilai| OP:NHOMO 34 OP:NHOMOORG 33 OP:PATTERN -----------------------1-------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----11---11-11111111111---------11--12-111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 132-132,134-134,179-180,182-183| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccccEEEcccccccccccccccHHHHHHEEEEEcccccEEEEEcccccEEEEEEEccccEEEEEEccccccccEEEEEEccEEEEEEEcccccccccccEEEEcccccEEEEEEEEcccccHHHHHHHHHHHccccccccc //