Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAL42036.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:98 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL42036.1 GT:GENE AAL42036.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1017268..1017564 GB:FROM 1017268 GB:TO 1017564 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAL42036.1 GB:DB_XREF GI:17739412 LENGTH 98 SQ:AASEQ MPLFIVYGFVDFLVISLHCSGIAEKVFSPAPESWDFRLNEILISALQFDQLLFTGPRATSLFGVSFLRSPIPARRLSHFRQFRTKYAAFALVGAKGWL GT:EXON 1|1-98:0| TM:NTM 1 TM:REGION 1->23| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccc //