[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAL42304.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:REPEAT 2|1->15|31->45

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL42304.2 GT:GENE AAL42304.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1288164..1288403 GB:FROM 1288164 GB:TO 1288403 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAL42304.2 GB:DB_XREF GI:159139989 LENGTH 79 SQ:AASEQ MSRPRAINHDCLRSLSGISRRNSYSQIEADVARPQAIDPRCILSLYNEGMKSGGINRVQVEKYVEFNLVENYSVPAWYI GT:EXON 1|1-79:0| NREPEAT 1 REPEAT 2|1->15|31->45| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,6-7| PSIPRED ccccccccHHHHHHHHcHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHHccccEEEEEEEEEEEEEcccccccEEc //