[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAL42570.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:80 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->58 PF11930 * DUF3448 0.0007 19.5 41/82  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL42570.2 GT:GENE AAL42570.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1553110..1553352) GB:FROM 1553110 GB:TO 1553352 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAL42570.2 GB:DB_XREF GI:159140103 LENGTH 80 SQ:AASEQ MADNSSSARTSPTNHGKRSLSFGNTTRRVVATTRNPTYSFFTQQTKAFMIICLDRWRNRLPAGITQSSKEAWEEWRPLFA GT:EXON 1|1-80:0| SEG 24->37|nttrrvvattrnpt| HM:PFM:NREP 1 HM:PFM:REP 18->58|PF11930|0.0007|19.5|41/82|DUF3448| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18| PSIPRED cccccccccccccccccEEEcccccEEEEEEEccccccHHEEccccEEEEEEEHHHHcccccccccccHHHHHHHccccc //