[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAL42723.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:66 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->30 PF10853 * DUF2650 0.00045 41.7 12/38  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL42723.2 GT:GENE AAL42723.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1711857..1712057 GB:FROM 1711857 GB:TO 1712057 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAL42723.2 GB:DB_XREF GI:159140166 LENGTH 66 SQ:AASEQ MSVIVKTVPRTLKPAGDGEIWHYWQCAGSLPPLPNPLTPTKSSEQSHGYFTGGDMRSPLPCRFHSG GT:EXON 1|1-66:0| SEG 30->40|lpplpnpltpt| HM:PFM:NREP 1 HM:PFM:REP 19->30|PF10853|0.00045|41.7|12/38|DUF2650| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,39-47,65-67| PSIPRED ccEEEEEccccccccccccEEEEEEEccccccccccccccccccccccEEcccccccccccEEccc //