[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAL42948.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL42948.1 GT:GENE AAL42948.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1920852..1921145 GB:FROM 1920852 GB:TO 1921145 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAL42948.1 GB:DB_XREF GI:17740406 LENGTH 97 SQ:AASEQ MSTLPDNDNGRDEPMVFIVIGKAYETDNSEGIDIHVILRAPDDDTAVRETLNALSEEGFIEADLDQIGMLTEIPDEEPHASAYQGALEGEVAIIRFA GT:EXON 1|1-97:0| OP:NHOMO 15 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------------1--12-111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED cccccccccccccccEEEEEEEEEEcccccEEEEEEEEEccccHHHHHHHHHHHHHccHHHHHHHHHccccccccccccHHHHccccccEEEEEEEc //