[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAL43062.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->67 PF11392 * DUF2877 0.00019 17.5 63/111  
:BLT:SWISS 1->62 GPMI_VIBVY 6e-04 35.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL43062.2 GT:GENE AAL43062.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2032766..2032993) GB:FROM 2032766 GB:TO 2032993 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAL43062.2 GB:DB_XREF GI:159140311 LENGTH 75 SQ:AASEQ MSSEYVAGLCLVAQIGAVHAERFERLVVEVQKGGVNMTADLTLACFNDAIEGGAEERFCHCFKSFFARRVSLSLC GT:EXON 1|1-75:0| BL:SWS:NREP 1 BL:SWS:REP 1->62|GPMI_VIBVY|6e-04|35.5|62/510| HM:PFM:NREP 1 HM:PFM:REP 5->67|PF11392|0.00019|17.5|63/111|DUF2877| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccc //