[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAL43364.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL43364.1 GT:GENE AAL43364.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2348957..2349247) GB:FROM 2348957 GB:TO 2349247 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAL43364.1 GB:DB_XREF GI:17740860 LENGTH 96 SQ:AASEQ MAAPSALPASRMPVSSPSRTEMARSEASLATISFARSIAQRPKSPRLSIEIVSMAKTFPRFDIVVPYPIGGKTGIGAAGVAHNFQACKMPAACGDL GT:EXON 1|1-96:0| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-25| PSIPRED ccccccccccccccccccHHHHHHHHccHHHHHHHHHHHHccccccEEEEEEEEcccccccEEEEEEcccccccccHHHHHccHHHHcccHHHccc //