Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAL43471.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL43471.1 GT:GENE AAL43471.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2453426..2453620 GB:FROM 2453426 GB:TO 2453620 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAL43471.1 GB:DB_XREF GI:17740976 LENGTH 64 SQ:AASEQ MEQDYENWATTVAYSIVMHEGLDLALSAQNLDRGKTRNNRERLMEAIRTSLLEARSRSGHLTAA GT:EXON 1|1-64:0| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,5-5,32-38,58-65| PSIPRED cccHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccccc //