[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAL43641.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  59/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.206.1
:183 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  78->181 1n91A_ d.206.1.1 * 3.8e-21 41.4 %
:RPS:PFM   92->167 PF02594 * DUF167 7e-17 56.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL43641.1 GT:GENE AAL43641.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2643260..2643811 GB:FROM 2643260 GB:TO 2643811 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAL43641.1 GB:DB_XREF GI:17741163 LENGTH 183 SQ:AASEQ MGADRQCYFFLALRLQRHQFPQPVRERHREFPGECHGTGPAPHPPHSAQSRRYRHLADHPAPDHLLHPLLHVEHALPDDCLSGLWRKHDDHVRLSVRLTPNGGRDAIDGVEQDADGNAHLKARVSAVPEGGKANKALIVLLAKKLGLPKSSITFISGETARKKILRIDTDPEDFEKLFKKLAG GT:EXON 1|1-183:0| SEG 55->77|hladhpapdhllhpllhvehalp| RP:PFM:NREP 1 RP:PFM:REP 92->167|PF02594|7e-17|56.3|71/77|DUF167| HM:SCP:REP 78->181|1n91A_|3.8e-21|41.4|99/108|d.206.1.1|1/1|YggU-like| OP:NHOMO 61 OP:NHOMOORG 60 OP:PATTERN ----------------------------------------------------------------1--- ---------------------------------------------------------------------------------1-----------------------------------11-1111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------11-111111111111111111------------1111111-11--12-1111111--111-1----1-----------------1111--------------------------------1--------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,42-51,183-184| PSIPRED cccccEEEEEEEEEHHHHHccHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHEEEcccEEEEEEEccccccccEEccccccccccEEEEEEEccccccHHHHHHHHHHHHHHcccHHHEEEEEcccccEEEEEEcccHHHHHHHHHHHcc //