[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAL43768.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:68 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->52 PF08410 * DUF1737 4e-14 63.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL43768.1 GT:GENE AAL43768.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2790025..2790231) GB:FROM 2790025 GB:TO 2790231 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAL43768.1 GB:DB_XREF GI:17741304 LENGTH 68 SQ:AASEQ MKVYRFITGPDDAKFCHRVTEALNKGWELAGSPSYAFNAASGVMHCGQAVTKVVEGKEYHPDMKLGEQ GT:EXON 1|1-68:0| RP:PFM:NREP 1 RP:PFM:REP 2->52|PF08410|4e-14|63.3|49/54|DUF1737| OP:NHOMO 46 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111---------11--12-11111111111---1111111111---------------------------------------------1-----------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111----------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,62-63,66-69| PSIPRED cccEEEcccccHHHHHHHHHHHHHcccEEEccccEEEcccccEEEEccEEEEEccccccccccHHccc //