[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ABW89714.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:43 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->38 PF09813 * Coiled-coil_56 8.1e-05 34.2 38/100  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABW89714.1 GT:GENE ABW89714.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 766569..766700 GB:FROM 766569 GB:TO 766700 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABW89714.1 GB:DB_XREF GI:159140655 LENGTH 43 SQ:AASEQ METVELSAAQKKSRRGRNIALGVLLAGLVVLFYVITIIKIGSH GT:EXON 1|1-43:0| TM:NTM 1 TM:REGION 19->41| SEG 20->31|algvllaglvvl| HM:PFM:NREP 1 HM:PFM:REP 1->38|PF09813|8.1e-05|34.2|38/100|Coiled-coil_56| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18,43-44| PSIPRED cccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //