[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ABW89719.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y8092_AGRT5  RecName: Full=UPF0314 protein Atu8092;

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:198 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   31->192 PF10755 * DUF2585 3e-59 68.5 %
:HMM:PFM   30->194 PF10755 * DUF2585 3.1e-87 64.2 165/165  
:BLT:SWISS 1->198 Y8092_AGRT5 e-116 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABW89719.1 GT:GENE ABW89719.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2675627..2676223) GB:FROM 2675627 GB:TO 2676223 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABW89719.1 GB:DB_XREF GI:159140670 LENGTH 198 SQ:AASEQ MTVAEMSASRSRSLRWFGVAAGLLLLQIVILYAMGRIPICECGYVKLFEPGVNTPGNSQHLADWYTPSHIIHGFLFYWFAWLLFRNKPFSMRLSFAVLIEAAWELLENSPIIIDRYRTATTALGYTGDSILNSAMDTVFMALGFLFAARVPVWLTVVIAIFFEIFTGWLIRDNLTLNVVMLVWPVDVIKEWQNALPQM GT:EXON 1|1-198:0| SW:ID Y8092_AGRT5 SW:DE RecName: Full=UPF0314 protein Atu8092; SW:GN OrderedLocusNames=Atu8092; ORFNames=Atu2691.1, AGR_C_4880; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->198|Y8092_AGRT5|e-116|100.0|198/198| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 18->40| TM:REGION 64->85| TM:REGION 141->163| TM:REGION 175->197| RP:PFM:NREP 1 RP:PFM:REP 31->192|PF10755|3e-59|68.5|162/165|DUF2585| HM:PFM:NREP 1 HM:PFM:REP 30->194|PF10755|3.1e-87|64.2|165/165|DUF2585| GO:PFM:NREP 1 GO:PFM GO:0005886|"GO:plasma membrane"|PF10755|IPR019691| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------111---1--------------1----------1--11-111111111-------1------------------------------------------------------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13,196-199| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEccccEEccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccc //