[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : aau3
DDBJ      :aau3         conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  479/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.49.1
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->77 1u02A PDBj 7e-04 37.7 %
:RPS:PDB   21->71 2acjC PDBj 6e-08 17.6 %
:RPS:SCOP  11->99 1f6vA  a.49.1.1 * 6e-16 22.5 %
:HMM:SCOP  2->136 1ylfA1 a.4.5.55 * 1.8e-38 43.3 %
:RPS:PFM   1->80 PF02082 * Rrf2 1e-16 51.2 %
:HMM:PFM   1->81 PF02082 * Rrf2 1.6e-28 46.9 81/83  
:BLT:SWISS 1->144 AAU3_RHIME 3e-68 85.4 %
:PROS 48->66|PS01332|HTH_RRF2_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86020.1 GT:GENE aau3 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(205480..205950) GB:FROM 205480 GB:TO 205950 GB:DIRECTION - GB:GENE aau3 GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86020.1 GB:DB_XREF GI:15155087 GB:GENE:GENE aau3 LENGTH 156 SQ:AASEQ MRLTKQTNYAVRMLMYCAANEGKLSRIPEIARAYGVSELFLFKILQPLNKAGLVETVRGRNGGVRLGKPAEKISLFDVVRVTEDSFAMAECFEDGAVECPLVDSCGLNSALRKALNAFFDVLAEYSIDDLVKARPQINFLLGIDTEMPKIAALPAA GT:EXON 1|1-156:0| BL:SWS:NREP 1 BL:SWS:REP 1->144|AAU3_RHIME|3e-68|85.4|144/154| PROS 48->66|PS01332|HTH_RRF2_1|PDOC01035| BL:PDB:NREP 1 BL:PDB:REP 8->77|1u02A|7e-04|37.7|69/222| RP:PDB:NREP 1 RP:PDB:REP 21->71|2acjC|6e-08|17.6|51/66| RP:PFM:NREP 1 RP:PFM:REP 1->80|PF02082|1e-16|51.2|80/83|Rrf2| HM:PFM:NREP 1 HM:PFM:REP 1->81|PF02082|1.6e-28|46.9|81/83|Rrf2| RP:SCP:NREP 1 RP:SCP:REP 11->99|1f6vA|6e-16|22.5|80/91|a.49.1.1| HM:SCP:REP 2->136|1ylfA1|1.8e-38|43.3|134/0|a.4.5.55|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 649 OP:NHOMOORG 482 OP:PATTERN -------------------------------------------------------------------- 1131--------1--------2---2------2222--22--11--------1--11-------1-1-----------2-1-1-------------------1-1-1--1---------------111--2---11-----11-11--------------------1----------------11111---2-111111111-1--11-422221-1111123512222221111111111111111----11----------------------------------------------------------------------1111411122321211-111-11211--1112-22221111321112-1-1111--1-111121---221-----11111111111-231131212211222122122211-2---2-32222212222222222221221---------11--1-11-11---11-------2321111111111111222211112222221211121--111111111122--21122111-111111111-211-1-1--24-32443-222223212222221112--------------------------222111-1-111111111111111111111---1231------21211111111111111-111111111111111111111122121121111111111111121111111--111111111111---1111-1111111--------------1-----11111-11-11111-------------1--------21111-----2122211111111111-1-------------------------------------------------2-----2--1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------2-----------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 75.6 SQ:SECSTR cTccHHHHHHHHHHTTcccTTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEcccccEEEEcccccHHHHHHHHHHHHHHHcTTHHHHHHHHHHTTcccHHHHHHHHHHHccc###################################### DISOP:02AL 1-2, 151-156| PSIPRED cccccHHHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccccccccHHHccHHHHHHHHcccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccccc //