[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : accD.1
DDBJ      :accD         acetyl-coenzyme A carboxyl transferase, beta subunit
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  785/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:298 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->287 2f9yB PDBj 1e-64 47.7 %
:RPS:PDB   18->58 1dl6A PDBj 1e-07 15.4 %
:RPS:PDB   40->272 3buzA PDBj 1e-36 9.0 %
:RPS:SCOP  26->287 2f9yB1  c.14.1.4 * 6e-70 49.2 %
:HMM:SCOP  26->288 2f9yB1 c.14.1.4 * 1.8e-75 38.4 %
:RPS:PFM   97->293 PF01039 * Carboxyl_trans 2e-31 42.2 %
:HMM:PFM   96->244 PF01039 * Carboxyl_trans 1e-21 29.9 147/493  
:BLT:SWISS 1->288 ACCD_METFK 6e-76 48.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85845.1 GT:GENE accD.1 GT:PRODUCT acetyl-coenzyme A carboxyl transferase, beta subunit GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 17231..18127 GB:FROM 17231 GB:TO 18127 GB:DIRECTION + GB:GENE accD GB:PRODUCT acetyl-coenzyme A carboxyl transferase, beta subunit GB:PROTEIN_ID AAK85845.1 GB:DB_XREF GI:15154880 GB:GENE:GENE accD LENGTH 298 SQ:AASEQ MNWITNYVRPRINSMLGRRPEVPENLWIKCPETGEMVFHKDLEDNKWVIPASGYHMKMPAKARLADLFDGGIYEALAQPKVAQDPLKFRDSKKYTDRLRDSRAKTEQEDTILAGVGLLKGLKIVAVVHEFQFMAGSLGIAAGEAIVKAFERAISERCPLVMFPASGGARMQEGILSLMQLPRTTVAVNMLKEAGMPYIVVLTNPTTGGVTASYAMLGDVHIAEPGAEICFAGKRVIEQTIREKLPEGFQTSEYLLEHGMVDMVIDRREIPDTLASMLKIMTKAPADNANAVVPLAASA GT:EXON 1|1-298:0| BL:SWS:NREP 1 BL:SWS:REP 1->288|ACCD_METFK|6e-76|48.3|288/289| BL:PDB:NREP 1 BL:PDB:REP 26->287|2f9yB|1e-64|47.7|256/257| RP:PDB:NREP 2 RP:PDB:REP 18->58|1dl6A|1e-07|15.4|39/58| RP:PDB:REP 40->272|3buzA|1e-36|9.0|221/413| RP:PFM:NREP 1 RP:PFM:REP 97->293|PF01039|2e-31|42.2|187/454|Carboxyl_trans| HM:PFM:NREP 1 HM:PFM:REP 96->244|PF01039|1e-21|29.9|147/493|Carboxyl_trans| GO:PFM:NREP 1 GO:PFM GO:0016874|"GO:ligase activity"|PF01039|IPR000022| RP:SCP:NREP 1 RP:SCP:REP 26->287|2f9yB1|6e-70|49.2|256/257|c.14.1.4| HM:SCP:REP 26->288|2f9yB1|1.8e-75|38.4|263/0|c.14.1.4|1/1|ClpP/crotonase| OP:NHOMO 924 OP:NHOMOORG 818 OP:PATTERN ------11111111111-------1112--11----------------------------------1- 111-2-11111-1-1-111-11--1211111111111322-112111211111111--112211-223231-111111-1113111111112-1--1--11111111221111111111111111213222122122335511-2211111111111111111111111111111111111111121111-122111111111111111112222111222211111111121111111111111111111111-111111-1-221111111111111111111111111111111111111111111111111111111111-11111111111112111111111---12111111121112-1121-11111111111111111111111111111111111111-1111111122111111221222111121111111111111111111111111213--------11------------------1111111122111111111111111111111-1111111122111211111121221331111111111111111112-1-111111121111111111111222221111111111111111111111111111111111111111--------------------1-11111------11111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122122111111111111111111--------------1-1-------------------------11-11-1111111 ------1----1--------------------------------------------------------------------------------------------------------------------------------------------------2--------------1-211------1---3--1--11112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 283 STR:RPRED 95.0 SQ:SECSTR ########cccccccHHccccccTcHHHHHHHHHHHHHHcccTTcHHHHHHHHHHHHccHHHHHHHHHHHHTHHHHHHHHHcGGGTcccHHHHHTcHHHHGGGHHHHHHHHHHHccccccEEEEEEcGGGGTcccccccTTcccccHHHHHHHHHHccEEEEEccccEEEEEEEEEEccccccTTcccEEEEEEEcTTcccEEEEETTEEEEEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEcccccTTcHHHHHHHHHHHHTTHHHHccTHHHHHHHHHHccccTTccc####### DISOP:02AL 8-24, 289-298| PSIPRED ccHHHHHcccccccccccccccccccEEEccccccEEEHHHHHHHHHHcccccccccccHHHHHHHHccccccccccccHHHccccccccHHHHHHHHHHHHcccccccEEEEEEEEEccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHccEEEEccccEEEEEcHHHHHHHHcccccccccHHHHHHHccEEEEEEccHHHHHHHHHHHHHHHHcccccccccccccccc //