[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : alaS.1
DDBJ      :alaS         alanyl-tRNA synthetase
Swiss-Prot:             

Homologs  Archaea  64/68 : Bacteria  467/915 : Eukaryota  118/199 : Viruses  0/175   --->[See Alignment]
b.43.3d.67.1
:245 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->236 2e1bA PDBj 2e-17 31.5 %
:RPS:PDB   2->238 2e1bA PDBj 3e-35 31.0 %
:RPS:SCOP  6->93 2e1bA1  b.43.3.6 * 3e-14 35.0 %
:RPS:SCOP  94->238 2e1bA2  d.67.1.2 * 2e-24 31.9 %
:HMM:SCOP  97->243 1v7oA_ d.67.1.2 * 4.7e-28 34.7 %
:RPS:PFM   5->97 PF01411 * tRNA-synt_2c 9e-10 42.9 %
:HMM:PFM   189->234 PF07973 * tRNA_SAD 7.8e-14 41.9 43/44  
:HMM:PFM   24->96 PF01411 * tRNA-synt_2c 1.4e-12 35.7 70/551  
:BLT:SWISS 6->226 SYA_PYRAR 1e-27 39.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87018.1 GT:GENE alaS.1 GT:PRODUCT alanyl-tRNA synthetase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1210203..1210940) GB:FROM 1210203 GB:TO 1210940 GB:DIRECTION - GB:GENE alaS GB:PRODUCT alanyl-tRNA synthetase GB:PROTEIN_ID AAK87018.1 GB:DB_XREF GI:15156264 GB:GENE:GENE alaS LENGTH 245 SQ:AASEQ MPVNALFRDDFYLSTAEAIVTAVHEDGGIELDQTCFYATSGGQPGDSGFLERADGSRIELGVTKNGADKSVIVHVPLEGQPSPEIGEKLTLHVDWPRRYKLMRMHTACHLLSVVCQWPITGAAVGEDESRVDFDMSETIEKDEVTAKLMELVKANHPVFLQWISDEELQANPGIVKSKNVRPPMGLGRVSLVCIGENSSIDSQPCGGTHVSETQEVGDIHIAKIEKKGKENRRFRIRFGAPEAAA GT:EXON 1|1-245:0| BL:SWS:NREP 1 BL:SWS:REP 6->226|SYA_PYRAR|1e-27|39.0|213/892| BL:PDB:NREP 1 BL:PDB:REP 6->236|2e1bA|2e-17|31.5|197/216| RP:PDB:NREP 1 RP:PDB:REP 2->238|2e1bA|3e-35|31.0|203/216| RP:PFM:NREP 1 RP:PFM:REP 5->97|PF01411|9e-10|42.9|84/546|tRNA-synt_2c| HM:PFM:NREP 2 HM:PFM:REP 189->234|PF07973|7.8e-14|41.9|43/44|tRNA_SAD| HM:PFM:REP 24->96|PF01411|1.4e-12|35.7|70/551|tRNA-synt_2c| GO:PFM:NREP 6 GO:PFM GO:0000166|"GO:nucleotide binding"|PF01411|IPR018164| GO:PFM GO:0004813|"GO:alanine-tRNA ligase activity"|PF01411|IPR018164| GO:PFM GO:0005524|"GO:ATP binding"|PF01411|IPR018164| GO:PFM GO:0005737|"GO:cytoplasm"|PF01411|IPR018164| GO:PFM GO:0006412|"GO:translation"|PF01411|IPR018164| GO:PFM GO:0006419|"GO:alanyl-tRNA aminoacylation"|PF01411|IPR018164| RP:SCP:NREP 2 RP:SCP:REP 6->93|2e1bA1|3e-14|35.0|80/87|b.43.3.6| RP:SCP:REP 94->238|2e1bA2|2e-24|31.9|119/129|d.67.1.2| HM:SCP:REP 97->243|1v7oA_|4.7e-28|34.7|144/155|d.67.1.2|1/1|ThrRS/AlaRS common domain| OP:NHOMO 873 OP:NHOMOORG 649 OP:PATTERN 221-122122222222322222211111211111111-111111111-11222133333231234-11 111-1-----------------------------------1---------------------1----1---1------111121------------------------1-11111111111111-1--1-1----12221111122-1-1--1--11------11--1-11---1111-11-1---1121-1--222221221222221-211--221-111-12------11-------------------------------------------------------------------------------------------12211111111-1--1--1---111-1111111--1---1-11121--111----11-1---1-221111211111111111112-11-11111111-2222222122121-1--221222211211111111-11-1-211-11111111--11--1111111111-11----1------2222221233322223333213222221--111--1111---2111111113--------1----1-----------11-1---------------------------------------1-1--11-111-11111-----11111111111-1---111--------1--111111-111111-1111111111111111111121--11111111111111111111111---11-111111111111-11111111---1-13121111-1111111111------------2111111211-1-11111111111111---111111-1---1111-1111111111-1111--11----------1111-1-----------------1111211-1-1-11-- ---------------11--1-11111-------2-1----------21--1222-1--11-1-21121-12-111121-2--1121-1----1-1----1-11---11-1237222121112214325-9D2-2-2122-21131-112-31-31222212122121211-2-121-1-8111-11121-----1112- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 242 STR:RPRED 98.8 SQ:SECSTR #cccccTTccTTccEEEEccccccccccccccccccccccTTcccccEEETTEETEEEEEEEEEEEccTTcccEEEEccGGGccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHcEEEEccccccEEEEEEEcccGGGHHHHHHHHHHHHHHcccEEEEEccccEEEEEEEHHEHHHHHTccEEEEEEEEEEcEETTccEEcccccccccGGGTccEEEEEEEEEETTEEEEEEEEEEccc## DISOP:02AL 244-245| PSIPRED ccEEEEEEcccccccEEEEEEEEcccEEEEEEccccccccccccccEEEEEEccccEEEEEEEEEEccccEEEEEEEEcccccccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccEEEEEEEccccccHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHccccccccccEEEEEEEEcccEEEEccccccccccccEEEEEEEEEEEEcccEEEEEEEEccccccc //