[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ameR
DDBJ      :ameR         transcriptional regulator, TetR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->108 2fbqA PDBj 8e-07 38.7 %
:RPS:PDB   34->213 2dg7A PDBj 2e-18 16.8 %
:RPS:SCOP  34->80 1vi0A1  a.4.1.9 * 2e-11 19.1 %
:RPS:SCOP  101->215 1t56A2  a.121.1.1 * 3e-08 11.4 %
:HMM:SCOP  18->101 1t33A1 a.4.1.9 * 6.9e-15 32.5 %
:HMM:SCOP  100->216 1rktA2 a.121.1.1 * 1.2e-06 23.9 %
:RPS:PFM   34->80 PF00440 * TetR_N 7e-08 44.7 %
:HMM:PFM   34->80 PF00440 * TetR_N 3.4e-17 38.3 47/47  
:BLT:SWISS 34->163 UIDR_SHIFL 1e-06 26.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88274.1 GT:GENE ameR GT:PRODUCT transcriptional regulator, TetR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2520165..2520824 GB:FROM 2520165 GB:TO 2520824 GB:DIRECTION + GB:GENE ameR GB:PRODUCT transcriptional regulator, TetR family GB:PROTEIN_ID AAK88274.1 GB:DB_XREF GI:15157738 GB:GENE:GENE ameR LENGTH 219 SQ:AASEQ MNKTIDQVRKGDRKSDLPVRRRPRRSAEETRRDILAKAEELFRERGFNAVAIADIASALNMSPANVFKHFSSKNALVDAIGFGQIGVFERQICPLDKSHAPLDRLRHLARNLMEQHHQDLNKNPYVFEMILMTAKQDMKCGDYYKSVIAKLLAEIIRDGVEAGLYIATDIPVLAETVLHALTSVIHPVLIAQEDIGNLATRCDQLVDLIDAGLRNPLAK GT:EXON 1|1-219:0| BL:SWS:NREP 1 BL:SWS:REP 34->163|UIDR_SHIFL|1e-06|26.0|123/196| SEG 20->32|rrrprrsaeetrr| BL:PDB:NREP 1 BL:PDB:REP 34->108|2fbqA|8e-07|38.7|75/213| RP:PDB:NREP 1 RP:PDB:REP 34->213|2dg7A|2e-18|16.8|173/185| RP:PFM:NREP 1 RP:PFM:REP 34->80|PF00440|7e-08|44.7|47/47|TetR_N| HM:PFM:NREP 1 HM:PFM:REP 34->80|PF00440|3.4e-17|38.3|47/47|TetR_N| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 34->80|1vi0A1|2e-11|19.1|47/72|a.4.1.9| RP:SCP:REP 101->215|1t56A2|3e-08|11.4|114/120|a.121.1.1| HM:SCP:REP 18->101|1t33A1|6.9e-15|32.5|83/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 100->216|1rktA2|1.2e-06|23.9|117/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 50 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------1--1--------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------122221--11111------------1121121--1---11123122212-1------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 187 STR:RPRED 85.4 SQ:SECSTR ################################HHHHHHHHHHHHccGGGccHHHHHHHTTccHHHHHHHcccTTGGGTTTccccHHHHHHHHHTccTTccHHHHHHHHHHHTTTTTTcTHHHcTTHHHHHHHHHGTcHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHTTTccccHHHHHHHHHHHHHHHHGGcccc DISOP:02AL 1-33, 217-219| PSIPRED ccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccc //