[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : arsH
DDBJ      :arsH         arsenical resistance protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  140/915 : Eukaryota  28/199 : Viruses  0/175   --->[See Alignment]
c.23.5
:229 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->229 2q62D PDBj e-101 78.8 %
:RPS:PDB   23->224 2b3dA PDBj 7e-29 13.4 %
:RPS:SCOP  7->220 2fzvA1  c.23.5.4 * 2e-46 62.6 %
:HMM:SCOP  19->225 2fzvA1 c.23.5.4 * 2.7e-59 41.6 %
:RPS:PFM   24->164 PF03358 * FMN_red 2e-09 34.1 %
:HMM:PFM   23->166 PF03358 * FMN_red 9.8e-31 30.9 139/146  
:BLT:SWISS 26->182 AZO1_STAAW 2e-06 27.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87280.2 GT:GENE arsH GT:PRODUCT arsenical resistance protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1478901..1479590) GB:FROM 1478901 GB:TO 1479590 GB:DIRECTION - GB:GENE arsH GB:PRODUCT arsenical resistance protein GB:PROTEIN_ID AAK87280.2 GB:DB_XREF GI:159140066 GB:GENE:GENE arsH LENGTH 229 SQ:AASEQ MQAQHLHGIDEQALRPAFSTHKPRILILYGSLREVSYSRLLAFEAGRLLERLGCEVRIFDPKGLPLPDETPASHAKVQELRDLSQWSEGQVWVSPERHGAMTGIMKSQIDWIPLAVGSVRPTQGKTLAVMEVSGGSQSFNAVNQMRILGRWMRMITIPNQSSVARAFQEFDEDGRMRPSSYYDRVVDVCEELVKFTLLTRDASAYLTDRYSERKEQAAELEKRVSLKSI GT:EXON 1|1-229:0| BL:SWS:NREP 1 BL:SWS:REP 26->182|AZO1_STAAW|2e-06|27.9|147/188| BL:PDB:NREP 1 BL:PDB:REP 4->229|2q62D|e-101|78.8|226/235| RP:PDB:NREP 1 RP:PDB:REP 23->224|2b3dA|7e-29|13.4|186/193| RP:PFM:NREP 1 RP:PFM:REP 24->164|PF03358|2e-09|34.1|135/149|FMN_red| HM:PFM:NREP 1 HM:PFM:REP 23->166|PF03358|9.8e-31|30.9|139/146|FMN_red| RP:SCP:NREP 1 RP:SCP:REP 7->220|2fzvA1|2e-46|62.6|214/233|c.23.5.4| HM:SCP:REP 19->225|2fzvA1|2.7e-59|41.6|202/0|c.23.5.4|1/1|Flavoproteins| OP:NHOMO 220 OP:NHOMOORG 168 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------222122211------1--1121121---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------1111-----11-111131--------------1-25134221----12211--22-111111--121111---111111111---------------------------------------12-111121111111----442-------1-1---1--1---1-21211-1-51---------------2------------------------------1-1----------------------------11---111--11--------------------------------------1-------------------------------11-1----11---1---------------1----1-------------------------1-1----------------1---1--111--1111-11-121111--1------------------------21-------1--------------------------------------------------------------- ----------------11213111211------1------------11-111-1--11----------------------------------1----1--1-------3---------------------------------------------------------------------------1----1--1-----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 229 STR:RPRED 100.0 SQ:SECSTR cccGGccccccccHHHHHHccccEEEEEEcccccTTcccHHHHHHHHHHHHHHcHHTTcEcccccEEEEEccccccHHHHHHHHHHccEEEEEEEccTTcccHHHHHHHHHHHHHTcTTTcccccccTTcTTcTTcccccTTcEEEEEEEccccTHGGccccTTcHHHcTTcTTTTccHHHHTHHHHHHHHHTTcEEcccEEcEccTTTcccTTTHHHHHHHHHHHTTc DISOP:02AL 1-3,16-16,208-222,228-230| PSIPRED ccHHHHccccHHHHcccccccccEEEEEEcccccccHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccHHHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHccEEEccccEEcccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcc //