[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : atpA.2
DDBJ      :atpA         ATP synthase alpha chain
Swiss-Prot:ATPA_AGRT5   RecName: Full=ATP synthase subunit alpha;         EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha;AltName: Full=ATP synthase F1 sector subunit alpha;

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
a.69.1b.49.1c.37.1
:509 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   13->508 1w0jC PDBj 0.0 71.8 %
:RPS:PDB   24->508 2ck3A PDBj e-133 73.2 %
:RPS:SCOP  24->94 1bmfA2  b.49.1.1 * 2e-17 71.8 %
:RPS:SCOP  95->379 1bmfA3  c.37.1.11 * 2e-23 78.9 %
:RPS:SCOP  381->508 1bmfA1  a.69.1.1 * 2e-38 61.7 %
:HMM:SCOP  9->94 1mabA2 b.49.1.1 * 1.4e-32 66.3 %
:HMM:SCOP  95->379 1e79A3 c.37.1.11 * 5.3e-110 46.3 %
:HMM:SCOP  380->510 1e79A1 a.69.1.1 * 2.2e-48 55.7 %
:RPS:PFM   25->92 PF02874 * ATP-synt_ab_N 4e-04 32.4 %
:RPS:PFM   148->372 PF00006 * ATP-synt_ab 6e-27 34.4 %
:RPS:PFM   384->457 PF00306 * ATP-synt_ab_C 2e-07 40.5 %
:HMM:PFM   148->372 PF00006 * ATP-synt_ab 8.5e-72 31.6 215/215  
:HMM:PFM   384->484 PF00306 * ATP-synt_ab_C 2e-27 42.4 99/113  
:HMM:PFM   25->92 PF02874 * ATP-synt_ab_N 3.6e-23 42.6 68/69  
:BLT:SWISS 1->509 ATPA_AGRT5 0.0 100.0 %
:PROS 363->372|PS00152|ATPASE_ALPHA_BETA

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88345.1 GT:GENE atpA.2 GT:PRODUCT ATP synthase alpha chain GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2607105..2608634) GB:FROM 2607105 GB:TO 2608634 GB:DIRECTION - GB:GENE atpA GB:PRODUCT ATP synthase alpha chain GB:PROTEIN_ID AAK88345.1 GB:DB_XREF GI:15157826 GB:GENE:GENE atpA LENGTH 509 SQ:AASEQ MDIRAAEISAILKDQIKNFGNEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLEADNVGVVIFGSDRSIKEGDTVKRTGAIVDVPVGPELLGRVVDALGNPIDGKGPINAAKRSRVDVKAPGIIPRKSVHEPMSTGLKAIDALIPVGRGQRELVIGDRQTGKTAIILDTILNQKAIHDNGPDGDKLYCVYVAIGQKRSTVAQFVKVLEERGALQYSIIVAATASDPAPMQYLAPFAGCAMGEYFRDNGKHALIGYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDEMGAGSLTALPVIETQGNDVSAFIPTNVISITDGQIFLETDLFYQGIRPAVNVGLSVSRVGSAAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDASTQRLLNRGARLTELLKQPQFSPLKTEEQVAVIFAGVNGYLDKIPVAQVGKFEQGFLSYLRSEGKAILDTIRTEKAISDDTKGKLKGALDNFAKSFS GT:EXON 1|1-509:0| SW:ID ATPA_AGRT5 SW:DE RecName: Full=ATP synthase subunit alpha; EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha;AltName: Full=ATP synthase F1 sector subunit alpha; SW:GN Name=atpA; OrderedLocusNames=Atu2624; ORFNames=AGR_C_4757; SW:KW ATP synthesis; ATP-binding; Cell inner membrane; Cell membrane; CF(1);Complete proteome; Hydrogen ion transport; Hydrolase; Ion transport;Membrane; Nucleotide-binding; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->509|ATPA_AGRT5|0.0|100.0|509/509| GO:SWS:NREP 11 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0045261|"GO:proton-transporting ATP synthase complex, catalytic core F(1)"|CF(1)| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 363->372|PS00152|ATPASE_ALPHA_BETA|PDOC00137| BL:PDB:NREP 1 BL:PDB:REP 13->508|1w0jC|0.0|71.8|496/498| RP:PDB:NREP 1 RP:PDB:REP 24->508|2ck3A|e-133|73.2|485/487| RP:PFM:NREP 3 RP:PFM:REP 25->92|PF02874|4e-04|32.4|68/68|ATP-synt_ab_N| RP:PFM:REP 148->372|PF00006|6e-27|34.4|212/212|ATP-synt_ab| RP:PFM:REP 384->457|PF00306|2e-07|40.5|74/106|ATP-synt_ab_C| HM:PFM:NREP 3 HM:PFM:REP 148->372|PF00006|8.5e-72|31.6|215/215|ATP-synt_ab| HM:PFM:REP 384->484|PF00306|2e-27|42.4|99/113|ATP-synt_ab_C| HM:PFM:REP 25->92|PF02874|3.6e-23|42.6|68/69|ATP-synt_ab_N| GO:PFM:NREP 9 GO:PFM GO:0015992|"GO:proton transport"|PF02874|IPR004100| GO:PFM GO:0016469|"GO:proton-transporting two-sector ATPase complex"|PF02874|IPR004100| GO:PFM GO:0046034|"GO:ATP metabolic process"|PF02874|IPR004100| GO:PFM GO:0046933|"GO:hydrogen ion transporting ATP synthase activity, rotational mechanism"|PF02874|IPR004100| GO:PFM GO:0046961|"GO:proton-transporting ATPase activity, rotational mechanism"|PF02874|IPR004100| GO:PFM GO:0005524|"GO:ATP binding"|PF00006|IPR000194| GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF00306|IPR000793| GO:PFM GO:0016820|"GO:hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances"|PF00306|IPR000793| GO:PFM GO:0033178|"GO:proton-transporting two-sector ATPase complex, catalytic domain"|PF00306|IPR000793| RP:SCP:NREP 3 RP:SCP:REP 24->94|1bmfA2|2e-17|71.8|71/71|b.49.1.1| RP:SCP:REP 95->379|1bmfA3|2e-23|78.9|285/285|c.37.1.11| RP:SCP:REP 381->508|1bmfA1|2e-38|61.7|128/131|a.69.1.1| HM:SCP:REP 9->94|1mabA2|1.4e-32|66.3|86/86|b.49.1.1|1/1|N-terminal domain of alpha and beta subunits of F1 ATP synthase| HM:SCP:REP 95->379|1e79A3|5.3e-110|46.3|285/0|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 380->510|1e79A1|2.2e-48|55.7|131/131|a.69.1.1|1/1|C-terminal domain of alpha and beta subunits of F1 ATP synthase| OP:NHOMO 4004 OP:NHOMOORG 1171 OP:PATTERN 22222222222222222222222222222222222222222222222622442122222222222222 3333222222222222222-22222222222222222222322232223223232222222232322222222222222222233733443423111111222221222244444444444444543222224224222222222344224422222222222422222222222222222222222244233333333333333333333333333333333335555553322222222222222222222422222222222222222222222222222222422422444242424444444444444422222222233333555555555535335444755443553333333353333333544335333332222535353333433433333333333-4444434444334333445333333233353364663332222222223352363222222222222222322222222222222223333444354446547575446588893834843332233433433342543335433363222222235523333523553335444433333357766563252333323333333333333333353222352333335353534355433343344443222533333133343344353553333233-543344333353523322322244544555555555555555532334334635666665565652242222223555428352222222222222222222222222534434333353333345422222222233336333337653333444444452222223533333333333323356----2-34342424346322863343233353353432 4444334-E6523444456444444454444344444434334354244444423443444444443423334434434444444334-464444444444549CB246395978744133453853837o6-5753424824784522253364D44656B56445A55B59556555l4465499DI4A64464444 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 509-510| PSIPRED ccccHHHHHHHHHHHHHcccccccEEEEEEEEEEEccEEEEccccccccccEEEccccEEEEEEEccccEEEEEEcccccccccccEEEEccccccccccHHHcccEEccccccccccccccccccccccccccccHHccccccHHHccHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHHHcccccccccEEEEEEEccccHHHHHHHHHHHcccccHHEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccEEEEEEEEcccccccccHHHHHHHHEEEEEEEcHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcc //