[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : c1
DDBJ      :c1           bacteriophage repressor protein C1
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  70/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
a.35.1b.87.1
:216 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   131->194 1jhfB PDBj 3e-04 43.5 %
:RPS:PDB   7->74 1b0nA PDBj 2e-05 21.9 %
:RPS:PDB   130->213 1ay9A PDBj 1e-12 25.9 %
:RPS:SCOP  1->73 2o38A1  a.35.1.13 * 2e-06 17.4 %
:RPS:SCOP  130->215 1f39A  b.87.1.1 * 5e-14 28.6 %
:HMM:SCOP  1->73 2a6cA1 a.35.1.13 * 0.00038 26.1 %
:HMM:SCOP  87->217 1jhfA2 b.87.1.1 * 1.1e-22 36.6 %
:HMM:PFM   134->197 PF00717 * Peptidase_S24 4.3e-16 30.2 63/70  
:HMM:PFM   8->40 PF01348 * Intron_maturas2 0.00036 42.3 26/146  
:BLT:SWISS 116->167 RPC_BP163 7e-08 44.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86296.1 GT:GENE c1 GT:PRODUCT bacteriophage repressor protein C1 GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(472247..472897) GB:FROM 472247 GB:TO 472897 GB:DIRECTION - GB:GENE c1 GB:PRODUCT bacteriophage repressor protein C1 GB:PROTEIN_ID AAK86296.1 GB:DB_XREF GI:15155410 GB:GENE:GENE c1 LENGTH 216 SQ:AASEQ MLSHETIWSAIDTLAERHQLTPSALAKRAGLDPTSFNKSKRFGPDGRKRWPSTESVSKVLEATGASVDQFFGYAFGRAQTMQPSGADNAIPLLGFAQAGSGGFFDDGGFPAGQGWDVVEFPSSPERKQGVYALEVQGESMMPLYRDGDILIVEPGAPVRRGDRVVLKSRDGEVMAKVLARQSPKNIELLSLNPEHPNRSFDMADVEWIARIIWASQ GT:EXON 1|1-216:0| BL:SWS:NREP 1 BL:SWS:REP 116->167|RPC_BP163|7e-08|44.2|52/263| SEG 94->114|gfaqagsggffddggfpagqg| BL:PDB:NREP 1 BL:PDB:REP 131->194|1jhfB|3e-04|43.5|62/111| RP:PDB:NREP 2 RP:PDB:REP 7->74|1b0nA|2e-05|21.9|64/103| RP:PDB:REP 130->213|1ay9A|1e-12|25.9|81/108| HM:PFM:NREP 2 HM:PFM:REP 134->197|PF00717|4.3e-16|30.2|63/70|Peptidase_S24| HM:PFM:REP 8->40|PF01348|0.00036|42.3|26/146|Intron_maturas2| RP:SCP:NREP 2 RP:SCP:REP 1->73|2o38A1|2e-06|17.4|69/89|a.35.1.13| RP:SCP:REP 130->215|1f39A|5e-14|28.6|84/101|b.87.1.1| HM:SCP:REP 1->73|2a6cA1|0.00038|26.1|69/0|a.35.1.13|1/1|lambda repressor-like DNA-binding domains| HM:SCP:REP 87->217|1jhfA2|1.1e-22|36.6|123/126|b.87.1.1|1/1|LexA/Signal peptidase| OP:NHOMO 71 OP:NHOMOORG 71 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------1--1111111111111111111-11111111111111111111111111111----------11111111111-111-------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------1---------------1------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 211 STR:RPRED 97.7 SQ:SECSTR HHHHHHHHHHHHHHTTTTTcccHHHHHHHTccHHHHHHHTTT###TcTccccHHHHHHTTTTTTccGGGTcHHHHHHHHHHHcccccccccccccccTTTTcccccccccccccccccccccccEEEEcEEEEEccccTTGGGccTTcEEEEEccccccTTcEEEEEcETTEEEEEEEEcccccccEEEcccTTcccEEcTTccEEEEEEEEEc## DISOP:02AL 1-2, 70-89| PSIPRED cccHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHcccccccccccccccccccEEEEEEEcccccccccccccccccccEEEEcccccccccEEEEEEEccccccccccccEEEEccccccccccEEEEEEccccEEEEEEEEEcccEEEEEEcccccccEEcccccEEEEEEEEEEEc //