[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : carA
DDBJ      :carA         carbamoylphosphate synthase small chain
Swiss-Prot:CARA_AGRT5   RecName: Full=Carbamoyl-phosphate synthase small chain;         EC=6.3.5.5;AltName: Full=Carbamoyl-phosphate synthetase glutamine chain;

Homologs  Archaea  62/68 : Bacteria  821/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
c.23.16c.8.3
:401 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->396 1jdbF PDBj e-104 51.5 %
:RPS:PDB   13->394 1cs0B PDBj 1e-95 48.7 %
:RPS:SCOP  13->167 1a9xB1  c.8.3.1 * 5e-54 47.7 %
:RPS:SCOP  168->393 1a9xB2  c.23.16.1 * 5e-78 52.0 %
:HMM:SCOP  11->165 1a9xB1 c.8.3.1 * 1.1e-48 46.4 %
:HMM:SCOP  168->395 1a9xB2 c.23.16.1 * 9.4e-63 37.4 %
:RPS:PFM   12->140 PF00988 * CPSase_sm_chain 4e-34 54.4 %
:RPS:PFM   218->385 PF00117 * GATase 7e-25 37.7 %
:HMM:PFM   13->145 PF00988 * CPSase_sm_chain 1e-50 52.7 129/131  
:HMM:PFM   210->387 PF00117 * GATase 5.9e-48 35.0 177/192  
:BLT:SWISS 1->401 CARA_AGRT5 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87915.2 GT:GENE carA GT:PRODUCT carbamoylphosphate synthase small chain GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2140140..2141345 GB:FROM 2140140 GB:TO 2141345 GB:DIRECTION + GB:GENE carA GB:PRODUCT carbamoylphosphate synthase small chain GB:PROTEIN_ID AAK87915.2 GB:DB_XREF GI:159140357 GB:GENE:GENE carA LENGTH 401 SQ:AASEQ MTETAPWTTRKPTAMLVLADGTVIEGTGIGATGKVQAEVCFNTALTGYEEILTDPSYLGQIVTFTFPHIGNVGTNEEDIEDLTPAARRGAVGVIFKADITDPSNFRAVKHLDAWLKARGVIGLCGIDTRALTAWIRENGAPNAVIAHDPNGVFDIEALKAEAKAWSGLVGLDLAIEATSGQSSTWTETPWVWNKGYGTLGEADAKYHVVCVDFGVKRNILRLFAGLDCKVTVVPAQTSAEDILALKPDGVFLSNGPGDPAATGEYAVPVIQNLIKSELPIFGICLGHQMLGLAVGAKTEKMHQGHHGANHPVKDFTTGKVEIVSMNHGFAVDTKSLPEGVEETHTSLFDGTNCGLRIVGKPVFSVQHHPEASPGPQDSHYLFRRFVNLLRENKGEAALAER GT:EXON 1|1-401:0| SW:ID CARA_AGRT5 SW:DE RecName: Full=Carbamoyl-phosphate synthase small chain; EC=6.3.5.5;AltName: Full=Carbamoyl-phosphate synthetase glutamine chain; SW:GN Name=carA; OrderedLocusNames=Atu2170; ORFNames=AGR_C_3938; SW:KW Amino-acid biosynthesis; Arginine biosynthesis; ATP-binding;Complete proteome; Glutamine amidotransferase; Ligase;Nucleotide-binding; Pyrimidine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->401|CARA_AGRT5|0.0|100.0|401/401| GO:SWS:NREP 7 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0006526|"GO:arginine biosynthetic process"|Arginine biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0006541|"GO:glutamine metabolic process"|Glutamine amidotransferase| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006221|"GO:pyrimidine nucleotide biosynthetic process"|Pyrimidine biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 13->396|1jdbF|e-104|51.5|375/380| RP:PDB:NREP 1 RP:PDB:REP 13->394|1cs0B|1e-95|48.7|374/378| RP:PFM:NREP 2 RP:PFM:REP 12->140|PF00988|4e-34|54.4|125/131|CPSase_sm_chain| RP:PFM:REP 218->385|PF00117|7e-25|37.7|167/185|GATase| HM:PFM:NREP 2 HM:PFM:REP 13->145|PF00988|1e-50|52.7|129/131|CPSase_sm_chain| HM:PFM:REP 210->387|PF00117|5.9e-48|35.0|177/192|GATase| GO:PFM:NREP 3 GO:PFM GO:0004086|"GO:carbamoyl-phosphate synthase activity"|PF00988|IPR002474| GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF00988|IPR002474| GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| RP:SCP:NREP 2 RP:SCP:REP 13->167|1a9xB1|5e-54|47.7|149/151|c.8.3.1| RP:SCP:REP 168->393|1a9xB2|5e-78|52.0|225/228|c.23.16.1| HM:SCP:REP 11->165|1a9xB1|1.1e-48|46.4|151/151|c.8.3.1|1/1|Carbamoyl phosphate synthetase, small subunit N-terminal domain| HM:SCP:REP 168->395|1a9xB2|9.4e-63|37.4|227/0|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 1925 OP:NHOMOORG 1074 OP:PATTERN 11-1-12111111121-222222131121222211223222222112211223212-1211111--11 2212211122222222223-22222122222222221222222221122221221212111211121232233333332-1212212222211111-1111111111121--------------122222222122222112222222222211322222221222122222223222223223231122122233333333233333322223233322234423333332211111111111111111111131511533223333111222312112221111122111111111111111111111111111111111114-23---111-1-1232222221-3--2122223222111212221-31122211221122221111111111111111111112-33333331213133332232223323232222222222222222222222122221111111111---------------11112111122222222222222222222222222222222222222222222222112221222222222112222222212221111111111122222222222123221223211111111111111112222311111112111221111111211111111111211122111111111222221112122211-11111221111211111121112233211111111111111112111111121222222222222112322122111122111---1-11----1--122222222222122222223222222222111111111211122222222211222222222223221122222222--------------------------------------2--21222221 11--113-311-1131223222222222222222222322232222222222222222222232222313223321212222222223-22222232223221343-23143322322122222432216H2-3221122212211221222122222226-13211211611312221I2212232532122243222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 388 STR:RPRED 96.8 SQ:SECSTR ############EEEEEETTccEEEEEEccccEEEEEEEEEEcccccHHHHHTcGGGcTEEEEEccccccTTcccGGGcccccccccHHHHEEEccccccccccTTccccHHHHHHHTTcEEEEcccHHHHHHHHHHHccEEEEEEEcccccccHHHHHHHHHHccccTTcccHHHHcccccEEEccccccTTTcccccccGGccEEEEEEEccccHHHHHHHHHTTEEEEEEETTccHHHHHTTcccEEEEcccccccTTcHHHHHHHHHHHTTTccccEEEEHHHHHHHHHHTccEEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEEcGGGccTTEEEEEEEcccccEEEEEEccccEEEEcccTTccccccTTTHHHHHHHHHHHHHHcEEEccc# DISOP:02AL 1-4,6-7,397-402| PSIPRED cccccccccccccEEEEEccccEEEEEEEccccEEEEEEEEEccccccccccccHHcccEEEEEcccccccccccHHHHHcccccccEEEEEEEEccccccccccHHHccHHHHHHHccccEEEcccHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHcccccccccccccccccccEEEcccccccccccccccccccccEEEEEEcccHHHHHHHHHHcccEEEEEEccccHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHccEEEEccccccccccEEEEcccccEEEEEEEEEEEEEEcccccccEEEEEEccccEEEEEEEccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHccccccc //